array_files=new Array();
array_files[0]=new Array(0,1,"./acapacific.html","2010-08-13","18K","CAYLX :: ACA Pacific    ","",""," CAYLX :: ACA Pacific -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube ACA Pacific – Technical Knowledge Excellence ACA Pacific is a privately held Australian leader in the distribution of Information Technology hardware and software. With over 15 years of experience and continual growth, ACA Pacific has earned itself a reputation within the storage sector for having a thorough knowledge of its customers’ needs and a firm grasp of technology. Having evolved from a volume distributor of storage products to today’s value-added solutions provider, our business approach emphasises customer service and technical excellence, enhancing our continued commitment to the channel. ACA Pacific Specializations ACA Pacific selects and focuses on quality products that represent the very best of a particular technology category, minimising competing products and enabling us to concentrate our efforts on developing the marketplace for the manufacturers whose products we represent. Over the years, ACA Pacific has shown the resilience and flexibility needed to maintain its position as one of Australia      ");
array_files[1]=new Array(0,1,"./search_results.html","2010-08-13","8K","CAYLX :: Contact Information    ","",""," CAYLX :: Contact Information -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 Elementia Home Index - Curtain Slider Index - Accordion Slider Index - Fading Slider Index - News Slider Index - No Slider Blog Portfolio Templates Index Index - Accordion Slider Index - Fading Slider Index - News Slider Index - No Slider Blog Single Blog Page Portfolio Page Page Page Fullwidth Contact Second Level » Just for Demonstration Purpose Contact These are the results of your search: You are here: Home » About » Philosophy » We love what we do RSS Facebook Twitter flickr Skype Latest News Our New Page is online Flash Slider Released Apple buys Microsoft Adobe buys Macromedia Pages Home Portfolio Contact About Us Jobs Philosophy Template Files Index Index - Fading Slider Blog Single Blog Page Portfolio Single Portfolio Page Page Page Fullwidth Contact Archive Miscellaneous Register Log in Terms of Service Contact Site Map HTML Template „Elementia“ Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. Ut enim ad minim veniam, quis nostrud exercitation ullamco lab. All content Copyright © 2010 Elementia, Inc top     ");
array_files[2]=new Array(0,1,"./products.html","2010-08-13","22K","CAYLX :: Products    ","",""," CAYLX :: Products -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Advanced Performance And Reliability Products CAYLX, both directly and through a worldwide group of partners, sells and supports a range of advanced performance and reliability products that enable businesses and enterprises to collect, store, manipulate and distribute information vital to the well being of the organization. The CAYLX product portfolio addresses all relevant current and future business segments. As a full-line provider who contributes enterprise experience to business critical computing (BCC), CAYLX is ideally positioned to support 24/7 (around-the-clock) e-business solutions and offer all platforms that are necessary to support the modern e-business. Autonomy Cardiff – Liquid Office LiquidOffice encompasses the entire business process management lifecycle from process design and simulation to deployment and optimization. However, it goes well beyond traditional process management. LiquidOffice embeds intelligence within forms and documents, enabling them to securely and automatically navigate the proc      ");
array_files[3]=new Array(0,1,"./contact.html","2010-08-12","20K","CAYLX :: Contact Information    ","",""," CAYLX :: Contact Information -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Contact Information Getting to CAYLX Do you need to come to our offices, or tell someone how to get here? The Google Street View map below will provide you with both the precise coordinates and photographs of our building and surrounding structures. Clicking on the address or View Larger Map links will open a larger version of the map. Click here to view larger map Contact Form Feel free to use the form below to contact us if you think we can help your company with your business process management requirements, or if you have any comments, requests or suggestions. Wed be pleased to hear from you, even if its just to say hello! label for=name Enter your full name* label for=email Enter a valid e-mail address* label for=phoneEnter a valid phone number label for=message class=blocklabelEnter your message* Data Privacy Data submitted via the form on this page will be used only for the purposes specified in our privacy policy or in relevant parts of the website. CAYLX will not, without your express consent, provi      ");
array_files[4]=new Array(0,1,"./thanks.html","2010-08-11","13K","CAYLX :: Thanks for your message!    ","",""," CAYLX :: Thanks for your message! -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Thanks for your message! We want you to be happy, since keeping people happy is good for business – ours and yours. Whatever your question or comment, a member of our team will review your submission and get back to you shortly with a response! If you need help more urgently, feel free to contact us using the details shown on the right of this page. Our Corporate Address NSW OFFICE LOCATION: CAYLX Software (Pacific) Pty. Ltd. Austlink Corporate Centre, L3, Suite 58 14 Narabang Way, Belrose, NSW 2085, Australia Contact Information SALES: 61 (2) 9986 1710 / 61 (2) 9986 1740 sales@caylx.com.au (Monday - Friday 9am-5pm) CUSTOMER SUPPORT: 61 (2) 9986 1710 / 61 (2) 9986 1740 support@caylx.com.au (Monday-Friday 9am-5pm) You are here: Home Contact Information » Thanks for your message! Recommended Products LiquidOffice TeleForm OnBase DvTDM Heads-Up for AP Kodak Scanners Pages Home Solutions Partners Products Support Contact Partner Websites CAYLX New Zealand Autonomy Cardiff Hyland Software Practical Programs      ");
array_files[5]=new Array(0,1,"./cardiff.html","2010-08-11","22K","CAYLX :: Partners :: Autonomy Cardiff    ","",""," CAYLX :: Partners :: Autonomy Cardiff -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Cardiff – An Autonomy Company Forms and documents are the fabric that connects people to business. Imagine the improvement you could see in your business if the ones you use everyday suddenly contained intelligence about where they needed to be routed and which systems needed the data they contained. What if you could automatically extract business information from paper documents as easily as from online forms? What if you could find any document at any time no matter who was working on it while resting assured that all of the information was secure from unauthorized access? Company Statistics Over 17,000 customers worldwide 4bn market capitalisation and 60m invested in R&D annually 75m cash in bank and no net debt 400 VARs and Integrators and 300 OEM Partners Cardiff Intelligent Documents And Their Key Benefits Cardiff Intelligent Documents have a conceptual understanding of the information they contain. This meaning-based approach enables each form or document to provide a richer user experience,      ");
array_files[6]=new Array(0,1,"./cardiff_ease.html","2010-08-11","20K","CAYLX :: Partners :: Cardiff :: Liquid Office :: Ease of Integration    ","",""," CAYLX :: Partners :: Cardiff :: Liquid Office :: Ease of Integration -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Liquid Office – Open & Easy To Integrate Being “Open” means delivering a complete set of application programming interfaces that allow businesses to efficiently and seamlessly integrate different components of their projects. Through an extensible set of pre-built Connect Agents and API’s Cardiff makes connecting with existing applications seamless for IT professionals. People. Information. Process. LiquidOffice encompasses the entire business process management lifecycle from process design and simulation to deployment and optimization. However, it goes well beyond traditional process management. LiquidOffice embeds intelligence within forms and documents, enabling them to securely and automatically navigate the process between people and systems, offering visibility into each step of the process and a complete audit trail. LiquidOffice is a cornerstone element of the Cardiff Intelligent Document platform, which offers the industry’s most comprehensive and ver      ");
array_files[7]=new Array(0,1,"./cardiff_intel.html","2010-08-11","22K","CAYLX :: Partners :: Cardiff :: Intelligent Documents    ","",""," CAYLX :: Partners :: Cardiff :: Intelligent Documents -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube The Cardiff Intelligent Document The Cardiff Intelligent Document is a new breed of business accelerating solutions. Created by breathing intelligence into electronic and paper documents, the Cardiff Intelligent Document is cognizant of its content, its environment and most importantly the rules that underlie your business. The embedded intelligence in these supercharged documents provides a rich user experience while ensuring the accuracy of the information collected. It knows the next step in the process, while allowing for human decision points and exception handling. It has the ability to initiate interactions with business systems as needed. The result: smoother processing for both your customers and your staff, dramatically reduced costs, and complete visibility. It’s as if an Invisible Workforce has stepped in to support your business goals. Furthermore, with the integration of Autonomys advanced content technologies, Cardiff provides insight and control across in-process ac      ");
array_files[8]=new Array(0,1,"./hyland.html","2010-08-11","20K","CAYLX :: Partners :: Hyland Software Solutions    ","",""," CAYLX :: Partners :: Hyland Software Solutions -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Hyland Software Solutions Established in 1991 and headquartered in Cleveland, Hyland Software Inc. strives to provide organizations with the tools and vertical expertise to become a paperless operation that is more efficient and effective. Developer of the award-winning OnBase enterprise content management (ECM) suite, Hyland is a customer-driven organization committed to service and support that goes beyond customer satisfaction to customer “delight.” Focusing on integrated document management, business process automation and records management, we provide our customers with improved access to information, increased process efficiencies and greater governance, risk and compliance to enable our customers to operate at their fullest potential. Hyland has and continues to develop OnBase as a customer- and user-friendly application. OnBase is rapidly deployable, easily configured and designed with our users in mind in order to ease the implementation process for the entire organization, in      ");
array_files[9]=new Array(0,1,"./hyland_live.html","2010-08-11","18K","CAYLX :: Partners :: Hyland Software Solutions :: Live Content    ","",""," CAYLX :: Partners :: Hyland Software Solutions :: Live Content -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Hyland Software Solutions – Live Content Feed The content below is provided through a live feed from Hyland Software, the developer of OnBase: The Hyland Customer Community One of Hyland’s five core values is, “Our customers are our partners.” And it’s not just something we talk about. It’s something every Hyland employee lives every day. We also believe that getting any software technology to meet its full potential takes a vibrant user community. That’s why we’ve developed our OnBase Customer Community. They’re dedicated to helping you get the most out of your OnBase solution. With our Customer Community, you have the opportunity to learn from your fellow OnBase peers and colleagues, as well as our experts. Users.OnBase.com Exclusively for OnBase users, Users.OnBase.com is the heart of our Customer Programs It’s the one place to go for all of our user resources. Whether you’re a user looking for business information or a System Administrator looking for      ");
array_files[10]=new Array(0,1,"./hyland_onbase_diff.html","2010-08-11","19K","CAYLX :: Partners :: Hyland Software Solutions :: The OnBase Difference    ","",""," CAYLX :: Partners :: Hyland Software Solutions :: The OnBase Difference -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube OnBase – Different and Much Better One Product, Countless Solutions Unlike many ECM offerings, OnBase is not a collection of acquired technologies. It is an organically and continuously developed suite of ECM applications that uses the same code base, user interface, content repository and security and administration modules. With both depth and breadth of enterprise-class product functionality, OnBase reduces administrative overhead and training costs and accelerates end user adoption by meeting the needs of multiple business areas. Stability, Innovation and Performance Both product development and corporate management demonstrate a consistent focus on continuous improvement, steady growth and delivering value. A privately owned company that hasnt been distracted by the challenges of market consolidation, Hyland Software has been consistently profitable, maintained growth rates that outpace the industry average and operates with the experienced management team that      ");
array_files[11]=new Array(0,1,"./hyland_onbase_integ.html","2010-08-11","20K","CAYLX :: Partners :: Hyland Software Solutions :: OnBase Integrations    ","",""," CAYLX :: Partners :: Hyland Software Solutions :: OnBase Integrations -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube OnBase Integration With Existing Business Applications Get More From The Data You Already Have Join the growing number of organizations using OnBase for software data integration – you’ll see that ROI rapidly follows. OnBase document management and data integration improves processes and reduces costs. Hylands integration partners include Microsoft®, SAP®, Oracle®, Lawson™ and ESRI®. OnBase certified integration solutions don’t need custom coding so systems integration won’t drain IT staff. Evolve your technology ecosystem with an integration between your business and enterprise software and OnBase. Your organization has software applications that run the business processes performed every day. But what about the paper that still bogs processes down? Through enterprise software integration with OnBase, employees and staff not only have data, they have the documents that go with it, all in one place. Connect software applications and unite them with relat      ");
array_files[12]=new Array(0,1,"./index.html","2010-08-11","16K","CAYLX :: Business Process Management (BPM) Solutions    ","",""," CAYLX :: Business Process Management (BPM) Solutions -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Collaborative solutions for Business Process Management (BPM) Total management of current and legacy documents - without headaches! Interactive management of the total drawing life-cycle Automatic and accurate capture of any and all business data CAYLX BPM means value, innovation and growth for your business CAYLX Software (Pacific) Pty. Ltd. is a leading provider of Business Process Management (BPM) solutions that integrate business intelligence and content management functions in best-of-type applications with demonstrable track records and excellent return on investment (ROI). CAYLX applications help companies bring greater efficiency to their decision-making processes, make the decisions traceable, and communicate them faster. Our solutions are based on fully integrated, industry-standard hardware platforms, allowing for an integrated approach that enables CAYLX to execute BPM projects significantly faster and more efficiently than the market average. Business Process Management T      ");
array_files[13]=new Array(0,1,"./library.html","2010-08-11","36K","CAYLX :: Library    ","",""," CAYLX :: Library -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube On-Line Library Browse our free online library for the latest technical whitepapers, videos and product information to help you make intelligent business product purchasing decisions. Asset Name File Type / Size CAYLX - Contact Cube Adobe Acrobat (PDF) / 197KB CAYLX - Liquid Office - Heads-Up for AP Adobe Acrobat (PDF) / 277KB CAYLX - Case Study - LiquidOffice - Coal Export Adobe Acrobat (PDF) / 190KB CAYLX - Case Study - Liquid Office eForms - Federal Government Adobe Acrobat (PDF) / 188KB CAYLX - Case Study - TeleForm - Superannuation Fund Adobe Acrobat (PDF) / 189KB Autonomy Cardiff - Company Overview Adobe Acrobat (PDF) / 1.55MB Autonomy Cardiff - IDF Company Profile Adobe Acrobat (PDF) / 229KB Autonomy Cardiff - Intelligent Document Processing Adobe Acrobat (PDF) / 1.40MB Autonomy Cardiff - Intelligent Documents. Better BPM Adobe Acrobat (PDF) / 627KB Autonomy Cardiff - Intelligent Documents for Accounts Payable Adobe Acrobat (PDF) / 597KB Autonomy Cardiff - Liquid Office Overview Adobe Acrobat (PDF) / 1.45MB Auton      ");
array_files[14]=new Array(0,1,"./management.html","2010-08-11","27K"," CAYLX :: The Management Team    ","",""," CAYLX :: The Management Team -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube The CAYLX Management Team With over 150 years of combined experience in the planning, development and delivery of interoperable BMP solutions, our integrated management team enables us to provide the highest levels of collaboration and consultation in support of BMP implementation decisions. The abilities of our management team cover a diverse set of skills, which complement each other in providing an holistic set of experiences and capabilities on which to build unique industry solutions. The team members evidence both depth and breadth in consulting, construction and life-cycle control of BMP system solutions. Jim Bullough – Managing Director Pacific Region Roles • Business Manager   • Principal Consultant – BPA   • Reseller Manager   • Supplier Contract Manager       Education • Diploma of Business Technology       Experience • Over 30 years in the computer industry   • Environments include NCR, IBM, Wang, HP, Unix and PCs   • Reseller and customer management   • Many yea      ");
array_files[15]=new Array(0,1,"./partners.html","2010-08-11","20K","CAYLX :: Partners    ","",""," CAYLX :: Partners -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube CAYLX Intelligent Business Partners At CAYLX, we know that partnerships are critical to our success and that of our customers. CAYLX is focused on working with well-established, best-in-class companies to add value to their offerings and to enhance our ability to support new and existing customers. The Power Of Partners CAYLX Partners are core to our business because we understand that providing customers with the very best in information management takes teamwork. That means leveraging one another’s expertise, best practices and sales experience. The CAYLX Partner Program was designed to deliver on that promise. We engage in a wide variety of upstream and downstream alliances with large and small companies to sustain growth and opportunity. Our partner program key goals are to: Provide the highest levels of service. Increase revenue and profits for all parties. Simplify doing business with CAYLX Software. Upstream Partnership – Autonomy Cardiff For the last 12 years, CAYLX has been supplying superior Autonomy Cardif      ");
array_files[16]=new Array(0,1,"./practical.html","2010-08-11","18K","CAYLX :: Partners :: Practical Programs    ","",""," CAYLX :: Partners :: Practical Programs -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Practical Programs – Making Organization Easy Practical Programs is an Australian headquartered company which, for close to a decade, has been authoring and distributing document and drawing management applications to a world-wide market. The company has come to intimately understand each and every problem that has to be addressed in the management of documents and drawings, and has developed an enviable reputation for delivering powerful, innovative and elegantly simple solutions to effectively meet all of those critical challenges. Such solutions are now being used in some 31 countries, by private and public sector clients such as: ABN Amro Amtrak Australian Central Credit Union Commonwealth Public Service Credit Union General Electric Hutchinson Telecom King Abdul Aziz Military Academy Oxford University Philips, TaTa South African Port Authority USACE - US Army Corp of Engineers The Australian / New Zealand / United States DoD Efficient Management Of Information Has Become A Critical Issue In a      ");
array_files[17]=new Array(0,1,"./privacy.html","2010-08-11","16K","CAYLX :: Privacy Policy    ","",""," CAYLX :: Privacy Policy -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Our Privacy Policy This privacy policy sets out how CAYLX uses and protects any information that you give CAYLX when you use this website. CAYLX is committed to ensuring that your privacy is protected. Should we ask you to provide certain information by which you can be identified when using this website, then you can be assured that it will only be used in accordance with this privacy statement. CAYLX may change this policy from time to time by updating this page. You should check this page from time to time to ensure that you are happy with any changes. This policy is effective from June 1, 2010. What Information We Collect Like most Web sites, CAYLX collects information automatically and through the use of electronic tools that may be transparent to our visitors. For example, we may log the name of your Internet Service Provider or use cookie technology. The cookie may store your user name and password, sparing you from having to re-enter that information each time you visit, or may control the number of times      ");
array_files[18]=new Array(0,1,"./products_cardiff.html","2010-08-11","21K","CAYLX :: Products :: Autonomy Cardiff    ","",""," CAYLX :: Products :: Autonomy Cardiff -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Autonomy Cardiff – Intelligent Document Solutions The Cardiff Intelligent Document is a new breed of business accelerating solutions. Created by breathing intelligence into electronic and paper documents, the Cardiff Intelligent Document is cognizant of its content, its environment and most importantly the rules that underlie your business. The embedded intelligence in these supercharged documents provides a rich user experience while ensuring the accuracy of the information collected. It knows the next step in the process, while allowing for human decision points and exception handling. It has the ability to initiate interactions with business systems as needed. The result: smoother processing for both your customers and your staff, dramatically reduced costs, and complete visibility. It’s as if an Invisible Workforce has stepped in to support your business goals. Cardiff provides insight and control across in-process activities and unstructured information. Having a better understanding of infor      ");
array_files[19]=new Array(0,1,"./products_headsup.html","2010-08-11","22K","CAYLX :: Products :: Autonomy Cardiff :: Heads-Up for Accounts Payable    ","",""," CAYLX :: Products :: Autonomy Cardiff :: Heads-Up for Accounts Payable -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Heads-Up for Accounts Payable Manually keying data from forms and documents into accounts-payable business systems is time-consuming, costly and error prone; with high potential for compliance or privacy violations due to operator error. The Problem You have thousands of invoices to process You have approvers & documents everywhere You need to pay on time You are fiscally responsible You are POTENTIALLY LIABLE! The HEADS-UP Solution Heads-Up for Accounts Payable is an automated processing platform based on commercial off the shelf products (COTS) from Cardiff Software, the world leader in process automation solutions. Intelligently Identifies and Processes Data Forms and documents come in all different formats, shapes and sizes and most of them are generated outside of your enterprise and outside of your control. Before they can be processed, they must be sorted. Based on their content, Cardiff TeleForm intelligently identifies form and document types of varied struc      ");
array_files[20]=new Array(0,1,"./products_hyland.html","2010-08-11","20K","CAYLX :: Products :: Hyland Software Solutions    ","",""," CAYLX :: Products :: Hyland Software Solutions -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Form Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Hyland – OnBase Enterprise Content Management Hyland Softwares OnBase product integrates document management, business process automation and records management. It is a single suite of enterprise content management (ECM) applications that uses the same user interface and content repository, but is configured to meet specific needs of individuals within an organization. Industry analysts such as Forrester Research focus on the products imaging and archiving capabilities as its strengths. OnBase provides several of the traditional ECM capabilities including capture, routing, managing, sharing and archiving. This ECM functionality is complemented with specific industry solutions and back office operations. OnBase is used by more than 7,200 mid-tier and Global 2000 enterprises to caApture, route, manage, share and archive high volumes of corporate information critical to business operations, audits, customer service, and other mission-critical business functions. OnBase ECM - A Technology-Enabl      ");
array_files[21]=new Array(0,1,"./products_kodak.html","2010-08-11","19K","CAYLX :: Products :: Kodak    ","",""," CAYLX :: Products :: Kodak -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Form Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Kodak Scanners – Capture-Based Solutions Kodaks Document Imaging business is the industrys leader of innovative document capture products, software and services. Kodak has the broadest portfolio of document capture products, software, capture-based solutions, and service and support to provide the most easy to use, accessible, scaleable, and affordable solutions for its customers to better capture, manage, archive and deliver critical business information. With over 75 years of expertise and a legacy of document imaging innovation, Kodak is the partner of choice for modern document imaging technology. Kodak offers the broadest range of scanners and integrated imaging equipment on the market. Product quality standards are exceptional, and performance is well established. Kodak develops innovative technologies, ranging from paper separation, document transport and multi-feed detection features to CCD sensors and image enhancement, along with advanced and easy-to-use solutions for reference archiving. Kodaks Imagi      ");
array_files[22]=new Array(0,1,"./products_kodak_i1200.html","2010-08-11","19K","CAYLX :: Products :: Kodak :: i1200 Series Scanners    ","",""," CAYLX :: Products :: Kodak :: i1200 Series Scanners -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Form Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Kodak i1200 – Small Footprint Departmental Scanners As a vital complement to departmental drawing and document management requirements, the simplex KODAK i1200 Series Scanner delivers the highest level of capability and affordability of any product in their category. This is true breakout performance, with ease of use, versatility and image quality that sets a new benchmark for small-footprint departmental scanners. With the KODAK i1200 Series Scanner, flexibility meets wide-ranging needs plus ease of use and high performance combine to deliver incredible value. With touch of a button, scan documents to: Files E-Mail Printers Desktop applications that support TIFF, JPEG, RTF PDF and searchable PDF In addition, this powerful scanner has a unique tilt-and-scan feature that allows you to select the best scan position for the job: Flat trays extended for higher-volume batch scanning. Fully upright with the input tray folded down for ad hoc and transaction scanning (you can even position the      ");
array_files[23]=new Array(0,1,"./products_kodak_i1300.html","2010-08-11","20K","CAYLX :: Products :: Kodak :: i1300 Series Scanners    ","",""," CAYLX :: Products :: Kodak :: i1300 Series Scanners -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Form Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Kodak i1300 – A Whole New Level Of Productivity When you want the power-user features of high-volume scanners in models perfectly suited for your departmental needs, see all that the new Kodak i1310 (simplex) and i1320 (duplex) Scanners can do. They deliver high-speed scanning to put some zoom in your throughput and productivity, delivering up to 60 ppm bitonal and grayscale, and 30 ppm color. Plus, youll appreciate innovative, new features like Smart Touch functionality: just push one scanner function button to launch one of nine scanning configurations, delivering preset scanner settings along with a variety of output formats and destinations. These include scan to applications, PDF, TIFF or JPEG, disk, e-mail, fax and printer. And theres more: optional A3 and A4 size tethered flatbed accessories, long (up to 863 mm/34 in) and small (ID-card size) document feeding, searchable PDF output, full integration with Kodak Capture Software and all the high-end features youve come to expect: e      ");
array_files[24]=new Array(0,1,"./products_lo.html","2010-08-11","22K","CAYLX :: Products :: Autonomy Cardiff :: LiquidOffice    ","",""," CAYLX :: Products :: Autonomy Cardiff :: LiquidOffice -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Autonomy Cardiff – LiquidOffice LiquidOffice encompasses the entire business process management lifecycle from process design and simulation to deployment and optimization. However, it goes well beyond traditional process management. LiquidOffice embeds intelligence within forms and documents, enabling them to securely and automatically navigate the process between people and systems, offering visibility into each step of the process and a complete audit trail. LiquidOffice is a cornerstone element of the Cardiff Intelligent Document platform, which offers the industry’s most comprehensive and versatile information capture and business process management capabilities. Cardiff Intelligent Documents streamline and simplify the complex maze between people, documents and processes that are critical to businesses, with a flexible and scalable architecture and no barriers between paper, online and mobile information. Cardiff Intelligent Documents are the information and process onramp to      ");
array_files[25]=new Array(0,1,"./products_lo_bpmsdk.html","2010-08-11","20K","CAYLX :: Products :: Autonomy Cardiff :: LiquidOffice :: LiquidBPM SDK    ","",""," CAYLX :: Products :: Autonomy Cardiff :: LiquidOffice :: LiquidBPM SDK -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube LiquidOfffice – LiquidBPM SDK LiquidBPM SDK is a robust and easily embedded BPM SDK that brings advanced process management capabilities to existing applications and systems. Ideal for independent software vendors (ISVs) and systems integrators (SIs), the LiquidBPM SDK is designed from the ground-up for rapid and tight integration with enterprise and vertical applications. Rapid integration capabilities Comprehensive BPM functionality Standards-based, modular approach for maximum flexibility High performance architecture Superior reliability and scalability Superior Design And Modeling LiquidBPM features an intuitive visual design environment that enables you to capture business processes with drag-and-drop simplicity. This visual design approach requires no programming expertise and can easily export defined processes in native, XML or Java formats. Process design is also aided by a series of comprehensive APIs, code generators for interfacing RMI, CORBA, EJB and We      ");
array_files[26]=new Array(0,1,"./products_lo_digitalapp.html","2010-08-11","21K","CAYLX :: Products :: Autonomy Cardiff :: LiquidOffice :: Digital Approval    ","",""," CAYLX :: Products :: Autonomy Cardiff :: LiquidOffice :: Digital Approval -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Form Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube LiquidOffice – Real, Digital Authenitification LiquidOffice provides LDAP authentication support for a range of built in digital approval options using HTML and PDF. Extended support includes digital signature standards incorporating PKI certificates and biometric signature devices from third party vendors for PDF forms, customers who require signing capabilities for low-risk transactions, including vacation requests, performance reviews, and engineering change orders. LiquidOffice Digital Approval provides an excellent solution for digitally approving forms and their data without having to invest and maintain a system that uses a PKI certificate based system as the means for digitally signing documents. LiquidOffice supports three levels of digital approval and signatures, and includes support for self authenticated and password/PIN protected digital form approval in HTML and PDF. LiquidOffice also supports certified PKI digital signature handlers. Digital Approva      ");
array_files[27]=new Array(0,1,"./products_lo_eforms.html","2010-08-11","20K","CAYLX :: Products :: Autonomy Cardiff :: LiquidOffice :: eForms    ","",""," CAYLX :: Products :: Autonomy Cardiff :: LiquidOffice :: eForms -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube LiquidOffice – eForms Now, more than ever before, organizations are investing in software solutions that reduce costs, increase productivity and improve customer service. For many organizations, the largest, most tangible savings are achieved by replacing manual paper processes with online forms and documents. As part of Cardiffs Intelligent Document Processing platform, LiquidOffice eForms provides an automated, rich, same-as-paper experience online. LiquidOffice eForms is a powerful, Web-based software solution for creating, deploying and automatically managing the routing, tracking and approval processes for electronic forms. LiquidOffice eForms capabilities range from internal corporate web forms to the comprehensive rules-based forms that drive the core of an organizations business. Intelligence is automatically built directly into the form to improve data accuracy and determine the correct business workflow, delivering the most efficient processes possible. In additio      ");
array_files[28]=new Array(0,1,"./products_lo_features.html","2010-08-11","21K","CAYLX :: Products :: Autonomy Cardiff :: LiquidOffice :: Features    ","",""," CAYLX :: Products :: Autonomy Cardiff :: LiquidOffice :: Features -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube LiquidOffice – Features The best means to ensure user adherence and acceptance to policies and regulations regarding information is by allowing users to interact with information in ways that are familiar to them while completely automating interaction and compliance requirements. Users must be provided the right amount of information at the right step in the process in order ensure optimal and compliant decision making. In reality, many organizations are finding that it is too ambitious to move an entire process online. As a result, paper-based stages become an obstacle that can neither be eliminated nor seamlessly incorporated. But this is a real strength of LiquidOffice. Using LiquidOffice, faxed, emailed, scanned or postage sent paper documents can be automatically classified and processed without the need for human intervention or manual data keying. The LiquidOffice eForms solution enables businesses to create, deploy and automatically manage the routing, tracking a      ");
array_files[29]=new Array(0,1,"./products_lo_formsdesign.html","2010-08-11","21K","CAYLX :: Products :: Autonomy Cardiff :: LiquidOffice :: Form Designer    ","",""," CAYLX :: Products :: Autonomy Cardiff :: LiquidOffice :: Form Designer -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Form Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube LiquidOffice Form Designer – Drag-And-Drop Ease LiquidOffice Form Designer was developed specifically to support distributed form design and to provide office workers with the ability to easily create and publish rich online forms. Rapid Design And Publishing LiquidOffice Form Designer is a drag and drop application that provides an intuitive, easy to use interface for novice form designers, while offering powerful tools, such as snap-to guides and comprehensive field setups, for more advanced form designers. LiquidOffice Form Designer comes with a wide selection of sample forms and a Gallery of pre-made form and field templates. Custom form elements can be created and saved into the Gallery, facilitating corporate standards for forms creation and design. LiquidOffice Form Designer also includes point and click controls for setting the attributes for database-driven pull-down menus, auto-fill fields based on user profile fields, electronic signatures, a comprehensive       ");
array_files[30]=new Array(0,1,"./products_lo_monandman.html","2010-08-11","20K","CAYLX :: Products :: Autonomy Cardiff :: LiquidOffice :: Monitoring and Management    ","",""," CAYLX :: Products :: Autonomy Cardiff :: LiquidOffice :: Monitoring and Management -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Form Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube LiquidOffice – Total Control Over All Processes LiquidOffice provides comprehensive monitoring and management features that protect your investment in processes, give you greater visibility into your business, and help enforce compliance requirements across the enterprise. With the ability to identify bottlenecks, audit usage, analyze processes and handle exceptions, LiquidOffice lets you make real-time improvements to the processes that drive your business. Enforcing compliance with corporate policies and an ever-increasing number of new regulatory requirements is one of your greatest challenges. Its one of the greatest strengths of LiquidOffice. LiquidOffice lets organizations track approvals, reviews, edits and business activity at every step of a process. This secure audit trail is crucial to meeting the requirements of Sarbanes-Oxley, HIPAA and other legislative mandates. Businesses can also establish rules, impose deadlines, and alert regulatory affa      ");
array_files[31]=new Array(0,1,"./products_lo_processdesign.html","2010-08-11","20K","CAYLX :: Products :: Autonomy Cardiff :: LiquidOffice :: Process Designer    ","",""," CAYLX :: Products :: Autonomy Cardiff :: LiquidOffice :: Process Designer -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Form Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube LiquidOffice Process Designer – Logical Processes LiquidOffice Process Designer is a graphical design application that allows business users to logically map the flow of a particular forms process with little or no coding required. Process Designer integrates with the LiquidOffice Form Server and LiquidOffice Process Engine to provide a comprehensive, server-based workflow environment enabling business users to define processes that involve human and automated tasks, transitions, decision points, automated notifications, sub-workflows and more. Point and click interfaces allow the quick design of structured workflows. Business processes can be modeled as workflows, which are collections of tasks that must be executed in a certain sequence. A task represents an atomic activity or unit of work. The business process defines the constraints in the form of rules, which are interpreted and imposed by the workflow engine as it orchestrates the execution of a workflow. Liq      ");
array_files[32]=new Array(0,1,"./products_lo_processorch.html","2010-08-11","20K","CAYLX :: Products :: Autonomy Cardiff :: LiquidOffice :: Process Orchestration Engine    ","",""," CAYLX :: Products :: Autonomy Cardiff :: LiquidOffice :: Process Orchestration Engine -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Process Orchestration Engine – Better Decisions LiquidOffice is the only BPM solution that combines enterprise-class search with the full range of structured, participant-driven, and self-altering process options. Collectively, these capabilities provide businesses with the real-time process control needed to deliver better decisions, increased employee productivity and more effective customer service. Powered by intuitive drag-and-drop technologies, the LiquidOffice Process Orchestration Engine accelerates the design and execution of structured processes for unique business requirements and regulatory compliance needs. No programming expertise is required. To effectively map structured workflows based on defined business rules, the LiquidOffice Process Orchestration Engine provides advanced features such as: In-Process Enterprise-Class Search The markets first and only in-process enterprise-class search surfaces content at the right step and time in a      ");
array_files[33]=new Array(0,1,"./products_onbase.html","2010-08-11","21K","CAYLX :: Products :: Hyland Software Solutions :: OnBase    ","",""," CAYLX :: Products :: Hyland Software Solutions :: OnBase -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Form Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube OnBase – The Fully-Integrated ECM Solution OnBase is a fully integrated enterprise content management (ECM) software suite used by more than 7,200 mid-tier and Global 2000 enterprises to capture, route, manage, share and archive high volumes of corporate information critical to business operations, audits and customer service. Built on a single platform, OnBase provides organizations with the ability to consistently capture and manage all of the following kinds of content without managing multiple applications: Imagescapturedwithhigh-orlow-volume scanning hardware, including multi-function devices. WebpagesconvertedtoTIFFimagesforcollection of items such as credit or other online reports. Datastreams,includingXMLandindustry-specifc data streams such as EDI835/837 andHL7. Documentsfromcommondesktopapplications such as Microsoft Word or Excel. Archiveddatafromenterpriseapplications, includingMicrosoftSharePointandSAPArchiveLink. EnterprisereportsimportedviaCOLD/ERMwithout running a s      ");
array_files[34]=new Array(0,1,"./products_onbase_modules.html","2010-08-11","19K","CAYLX :: Products :: Hyland Software Solutions :: OnBase :: Product Modules    ","",""," CAYLX :: Products :: Hyland Software Solutions :: OnBase :: Product Modules -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Form Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube OnBase – Modular Evolution For Business Growth The fully integrated OnBase product suite is categorized according to modules in order to ensure that users understand the functionality available and can purchase only the capabilities they need to solve their business problems. OnBases modular architecture and common code base ensure that organizations can quickly and easily add additional modules as budgets, business needs or mindshare evolve. The following section provides a brief overview of the most commonly used capabilities. Business Process Automation Modules provide the tools to eliminate manual labor in transactional processes while improving accountability and ensuring business agility. Content Management Modules are designed to consolidate and ensure availability of all of an organizations information assets, protect them from unauthorized viewing/modifications and increase accountability. E-Mail Modules help organizations gain control of the fastest gro      ");
array_files[35]=new Array(0,1,"./products_onbase_modules_bpa.html","2010-08-11","21K","CAYLX :: Products :: Hyland Software Solutions :: OnBase :: Product Modules :: Business Process Automation    ","",""," CAYLX :: Products :: Hyland Software Solutions :: OnBase :: Product Modules :: Business Process Automation -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Form Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube OnBase – Business Process Automation OnBase structures the organization of documents through the use of document types and document type groups. These conceptual repositories enable organizations to breakdown content into easily definable, truly manageable groups. Centralized and de-centralized storage and redundancy is offered to ensure that content remains secure and accessible across multiple locations. To ensure ease-of-use, OnBase places chief importance on the user experience. All user activity is performed quickly, consistently and securely through a single thin or thick client interface. The modular nature of OnBase opens up realms of functionality for automating critical business processes. Integration with enterprise and line of business systems erases the borders between applications and empowers users to create, access, cross-reference and process content across multiple hardware and application software environments usi      ");
array_files[36]=new Array(0,1,"./products_onbase_modules_eforms.html","2010-08-11","20K","CAYLX :: Products :: Hyland Software Solutions :: OnBase :: Product Modules :: E-Forms    ","",""," CAYLX :: Products :: Hyland Software Solutions :: OnBase :: Product Modules :: E-Forms -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Form Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube e-Forms – Streamlined Forms Capture OnBase E-Forms provides a standard means of initiating requests, notifications and other routine processes by allowing users to complete and submit online HTML forms that become immediately available for retrieval and routing. E-Forms also can play a central role in workflows, allowing users to create electronic documents to initiate, participate in or complete business processes. Used in conjunction with OnBase Workflow, E-Forms, can drive a completely paperless business process, whereby standardized internal documents (e.g. expense reports, purchase requisitions, vacation requests, etc.) are created and routed entirely within the OnBase system. Once a form is submitted, OnBase automatically indexes the document using fields on the form and makes it available for retrieval within OnBase. The form may trigger an OnBase Workflow, completing or initiating a work process. The addition of the OnBase Web Server to this co      ");
array_files[37]=new Array(0,1,"./products_onbase_modules_rules.html","2010-08-11","20K","CAYLX :: Products :: Hyland Software Solutions :: OnBase :: Product Modules :: Business Rules Engine    ","",""," CAYLX :: Products :: Hyland Software Solutions :: OnBase :: Product Modules :: Business Rules Engine -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Form Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Business Rules Engine – React & Adjust To Change The OnBase Business Rules Engine allows organizations to react quickly to changing business conditions, adjusting their approaches to markets or adding new lines of business. The Business Rules Engine is designed to allow managers to create business rules that contain parameterized values. This allows shift supervisors to adjust threshold values as needed to account for dynamic business environments. The Business Rules Engine is an add-on module for OnBase Workflow. It adds two tiers of client-side configuration privileges, which are assigned by Workflow administrators. The Business Rules Engine configuration interface reduces the need for developing custom solutions using e-Forms and scripting. Because rules can be created and modified client-side, changes do not require restarting clients and disrupting end users. In addition to the control and flexibility the Business Rules Engine adds t      ");
array_files[38]=new Array(0,1,"./products_onbase_modules_workflow.html","2010-08-11","26K","CAYLX :: Products :: Hyland Software Solutions :: OnBase :: Product Modules :: Workflow    ","",""," CAYLX :: Products :: Hyland Software Solutions :: OnBase :: Product Modules :: Workflow -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Form Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube OnBase Workflow – Efficient, Fast And Accurate OnBase Workflow is an electronic document routing system that enables users to process work more efficiently, faster, and more accurately than with traditional paper processing. OnBase Workflow is beneficial whenever successive points of input or action are required in order to complete a task, process, or procedure. From processing applications to approving expense reports to managing remittance processing, workflow streamlines collaboration and accelerates the completion of critical business tasks. Additionally, OnBase Workflow can easily integrate with and provide the backbone to e-commerce solutions as well as be tied to organizations core ERP and CRM systems. With OnBase Workflow, users or integrators define and configure document states, rules, actions, and lifecycles with a comfortable Windows interface. Upon configuration, workflow instantly routes documents through the business process as each in      ");
array_files[39]=new Array(0,1,"./products_onbase_modules_workview.html","2010-08-11","21K","CAYLX :: Products :: Hyland Software Solutions :: OnBase :: Product Modules :: Workview    ","",""," CAYLX :: Products :: Hyland Software Solutions :: OnBase :: Product Modules :: Workview -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Form Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube OnBase Workview – Customizable And Scalable WorkView is an OnBase solution that enables organizations to view and track both information and interactions surrounding a specific business process. Core business processes are rarely carried out without human interaction. With the growing concern of risk and compliance, these human interactions need to be captured and associated with relevant documents and processes. WorkView is a fully customizable, scalable solution that will not only capture these interactions, but also tie together the supporting documents and information generated and transitioned through a business process. OnBase WorkView provides views into each step within a given process. Each view provides a mechanism for understanding and tracking a case working its way through the system. A case is an assortment of information consisting of records, events, interactions and documents pertaining to a single definable instance. Whether the busi      ");
array_files[40]=new Array(0,1,"./products_practical.html","2010-08-11","19K","CAYLX :: Products :: Practical Programs    ","",""," CAYLX :: Products :: Practical Programs -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Form Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Practical Programs – Addressing Critical Issues Organisations searching for better ways to manage the ever increasing volume of information generated, received, processed and stored by their employees every day, need look no further than Practical Programs. In an increasingly information intensive age, management of information has become a critical issue. There has never been a greater imperative for organisations to embrace IT innovations and become more organised. While organisations have harnessed IT tools to manage most information processing functions – using programs to process words, numbers, drawings and images – they have often failed to implement the very program which would help them manage this vast volume of information, a document management system. Better Document Management Document management industry data research (Gartner) indicates that knowledge workers waste 20 percent to 30 percent of their time on document management related tasks. It is estimated that professionals spe      ");
array_files[41]=new Array(0,1,"./products_practical_dvemail.html","2010-08-11","19K","CAYLX :: Products :: Practical Programs :: DvEMail    ","",""," CAYLX :: Products :: Practical Programs :: DvEMail -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Form Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube DvEMail – Meeting The E-Mail Challenge Today, one of the newest of document management challenges has to do with effectively storing, controlling and accessing email, a challenge that Practical Programs has met with DvEMail Management; the latest solution to be added to the Practical Programs Dv Family of essential document management tools. The Big Email Question – Who Sent What To Whom? Practical Programs recognizes that the email systems in use were never designed to handle the volume and range of data that we are now forcing through them; a fact that regrettably means that storage is cumbersome and retrieval difficult. The way those systems work also means that emails and other types of records are not automatically stored together, with the result that there is no logical bringing together of the great many emails – and the attached Word, Excel, PowerPoint and graphics files – that, over time, we may send or receive. The problem is made all the worse when other individuals in th      ");
array_files[42]=new Array(0,1,"./products_practical_dvscan.html","2010-08-11","19K","CAYLX :: Products :: Practical Programs :: DvScan and DvScan Pro    ","",""," CAYLX :: Products :: Practical Programs :: DvScan and DvScan Pro -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Form Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube DvScan / DvScan Pro – Easy And Accurate Scanning While many files, letters, attachments and the like are now sent electronically, organizations are all still confronted by the large number of hardcopy documents that are constantly arriving from within and without the organization. We remain a very long way away from the paperless office; scanning software is essential for any company that needs to capture hard-copy documentation. When used for front-end document capture to the Practical Programs DvTDM and DvOffice management systems, DvScan accelerates business processes by collecting documents, transforming them into accurate, retrievable information, and delivering them into business applications and databases. With DvScan, paper documents are scanned directly into DvTDM for indexing, automatically assigned the correct security status, and are immediately ready for use throughout the organization. What Happens If Hard-Copy Data Is Neglected? Productivity losses searching       ");
array_files[43]=new Array(0,1,"./products_practical_dvtdm.html","2010-08-11","23K","CAYLX :: Products :: Practical Programs :: DvTDM and DvOffice    ","",""," CAYLX :: Products :: Practical Programs :: DvTDM and DvOffice -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Form Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube DvTDM And DvOffice – Best Of Breed Solutions Data Viewer Total Document Management (DvTDM) will help regain control of the information thats central to your organisations workflow processes, while significantly improving workplace efficiencies and reducing the cost of doing business. DvTDM equips progressive organisations with the expertise and tools to better manage the creation, capture, organization, storage, retrieval, manipulation and controlled circulation of drawings, CAD files and business documents. While most document management software developers claim they can manage drawings i.e. their software may allow you add a drawing to the database and control access to who can check in and checkout the document, DvTDMs features far exceed these simple functions. DvTDM is a powerful and robust tool for managing everything from business documents to technical documents and drawings. DvTDM supports over 200 Engineering and Office document formats including: AutoCAD, Microstat      ");
array_files[44]=new Array(0,1,"./products_teleform.html","2010-08-11","23K","CAYLX :: Products :: Autonomy Cardiff :: TeleForm    ","",""," CAYLX :: Products :: Autonomy Cardiff :: TeleForm -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube TeleForm – Any Form, Any Document, Anytime Nowhere is the need for automation, visibility and control greater than in the document-driven processes that power business in the modern enterprise. Whether it’s the service requests in Financial Services, the work orders in Manufacturing or the invoices in Accounting, more than 80% of all business documents and forms are still processed manually today. TeleForm is the only solution to combine world-class information capture with Meaning-Based Computing (MBC) technology, successfully integrating people, paper and processes. It offers the unrivalled flexibility to capture information from document and form paper-based sources and seamlessly incorporate it into secure, automated business processes. Capture Information Automatically TeleForm delivers a complete range of alternatives for capturing paper and electronic forms and documents from distributed knowledge workers or external customers and partners, via fax, email, internet, postage, sca      ");
array_files[45]=new Array(0,1,"./products_teleform_features.html","2010-08-11","20K","CAYLX :: Products :: Autonomy Cardiff :: TeleForm Features    ","",""," CAYLX :: Products :: Autonomy Cardiff :: TeleForm Features -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube TeleForm – Feature Rich Data Capture TeleForm provides an easy-to-use, scalable platform that equips organizations to capture data from almost any source in a secure, dependable environment; and then to track, audit and search the process behind the form giving you maximum efficiency and ensuring compliance to organization and government regulation. TeleForm features include: Form Designer A point-and-click application for easily implementing automated forms processing and document capture. Designer includes complete layout tools to create new forms and to automate your existing forms and document types. Flexible Document Input Options Out-of-the box interfaces to scanners, fax, email, file systems and internet. View and Index Non-image File Types Supports viewing of word processing, spreadsheet, presentation, graphic, multimedia, and other formats without needing the native file application. Content-based Classification Automatically classifies and sorts forms and semi- and uns      ");
array_files[46]=new Array(0,1,"./products_teleform_idr.html","2010-08-11","20K","CAYLX :: Products :: Autonomy Cardiff :: TeleForm Intelligent Document Recognition    ","",""," CAYLX :: Products :: Autonomy Cardiff :: TeleForm Intelligent Document Recognition -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube TeleForm – Rules-based Document Understanding TeleForm Intelligent Document Recognition (IDR) allows organizations to dramatically reduce data entry costs, streamline internal operational processes, accelerate the delivery of data and documents to back-end systems, and employ automated business rules to reduce data errors. Using Intelligent Document Recognition, corporations can support intelligent routing, tracking and secure digital approval, all over the Internet. Once the data is received from the customer, the process can be handled entirely online. TeleForms IDR capture provides the ability to make sense of and help manage the unstructured, untagged information coming into the corporation or organization. It provides the front-end understanding needed to feed business process management (BPM) and business intelligence (BI) applications, as well as traditional accounting and document or records management systems. TeleForms IDR Capture has evolved in      ");
array_files[47]=new Array(0,1,"./products_teleform_roi.html","2010-08-11","22K","CAYLX :: Products :: Autonomy Cardiff :: TeleForm Return on Investment (ROI)    ","",""," CAYLX :: Products :: Autonomy Cardiff :: TeleForm Return on Investment (ROI) -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube TeleForm – Intelligent Application, Excellent ROI TeleForm is the only comprehensive solution to combine world-class capture with intelligent form and document processing, successfully integrating people, paper and processes. TeleForm offers a compelling ROI that has been proven repeatedly. Using only the intelligent data extraction capability, customers typically see a 60%+ reduction in costs associated with manual data entry. This ROI is realized because TeleForm intelligently identifies any form or document type and automatically sorts scanned documents into “virtual sets” that can be efficiently processed and validated without manual intervention.  Then TeleForm reads the hand-print (ICR), machine print (OMR), optical mark (OMR), barcodes, and signatures from paper forms and documents, virtually eliminating all human intervention and errors. The reduction in human manual data entry, human errors and accelerated processing times are reflected immediately i      ");
array_files[48]=new Array(0,1,"./solutions.html","2010-08-11","18K","CAYLX :: Intellilgent Business Solutions    ","",""," CAYLX :: Intellilgent Business Solutions -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube CAYLX Intelligent Business Solutions Whether you’re exploring a simple electronic document management solution to fulfill your most basic document imaging and storage needs, or require more robust enterprise content management functionalities for BPM and workflow control, CAYLX can provide the ideal intelligent business solution to increase your office productivity. CAYLX offers both off-the-shelf and turnkey solutions from proven applications authors. With CAYLX electronic information management products and services, our customers have streamlined operations and reduced costs, all while enjoying the highest levels of enterprise content management security available today. We are committed to understanding your business processes, the challenges you face, and the goals you wish to achieve. Look to CAYLX for the perfect solution. The Benefits Of A CAYLX Intelligent Business Solution The specific benefits to be gained from introducing an information management system vary from case to case, depe      ");
array_files[49]=new Array(0,1,"./solutions_bpm.html","2010-08-11","19K","CAYLX :: Solutions :: Business Process Management    ","",""," CAYLX :: Solutions :: Business Process Management -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube BPM – Connecting Information, People And Systems A business process is a set of coordinated tasks and activities, conducted by both people and equipment, that will lead to accomplishing a specific organizational goal. Business Process Management (BPM) is a systematic approach to improving business processes by consolidating all the information required to make business decisions, conveying the information to the people who need it, and conserving the information in secure storage - where its retained as an easily retrievable asset. While the overall concept of BPM can be seen as a three part process (consolidate, convey, conserve), the CAYLX approach consists of four inter-connected and continuous parts, all conducted in collaboration and consultation with the client: Model And Simulate Identify business goals, processes, tasks and responsibilities. Model and simulate processes across domain to demonstrate viability of concept. Design And Build Create workflow logic and construct compone      ");
array_files[50]=new Array(0,1,"./solutions_datacap.html","2010-08-11","20K","CAYLX :: Solutions :: Data Capture    ","",""," CAYLX :: Solutions :: Data Capture -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Automated Data Capture – Accurate Every Time Capturing data correctly the first time is the key step in keeping data pristine, and OCR technology is a critical component in achieving this. Modern OCR technology can automatically read form data and, with error tolerances set very high, can â€�read’ at near 100% accuracy. The additional functionality of a CAYLX data capture solution ensures you data is captured automatically and accurately, each and every time. Scalability Scalable data capture software solutions can greatly reduce cost and operator fatigue. Scalability is achieved through replication technology so manual data entry can be done at geographically dispersed keying sites. The keying and verification modules should be deployed to optimize the scope, productivity, and accuracy of the work performed at manual keying locations. The Importance Of Keying And Verification Keying and verification modules optimize the scope, productivity, and accuracy of work performed at manual keying locations.       ");
array_files[51]=new Array(0,1,"./solutions_docman.html","2010-08-11","20K","CAYLX :: Solutions :: Document Management Solutions    ","",""," CAYLX :: Solutions :: Document Management Solutions -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Document Management – Its Not Just About Storage Most businesses and organizations rely on their documents to store data and keep information readily available, with some corporations creating millions of documents each year. Filing data that is collected, storing it safely, indexing it properly, making it easily accessible and protecting it from outsiders are major concerns for many organizations. The technical categories to be considered when choosing a document management system include: storage, retrieval, filing, security, archival, retention, distribution, workflow, and creation - all integral parts of the CAYLX Intelligent Document Management Architecture. Creation And Capture It is important to consider how documents are created. A document may be created by one person, a team of people, an entire department, or may come from outside the organization. Regardless of the source of the document, the document management system must have in place a method of scanning the data into t      ");
array_files[52]=new Array(0,1,"./solutions_drawman.html","2010-08-11","19K","CAYLX :: Solutions :: Drawing Management    ","",""," CAYLX :: Solutions :: Drawing Management -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube Drawing Management – Best Practice Applications Short design times and fast change cycles drive earlier product launches. Manual product release and change processes waste time. Users must identify, locate and copy affected drawings; write, edit and correct the change order, and rely on one person at a time review, using either interoffice mail or an engineer or change analyst walking the change package from office to office. Drawings are the essential communication method for conveying design data, which in most cases are created using computer-aided design (CAD) software, but may occasionally include paper documents, photographic film, computer binary code on CD, and other physical media. Groups within and outside your company rely entirely on the accuracy and completeness of your engineering drawing package to efficiently realize the project design intent. Drawing Control Requirements Since the drawing package forms the foundation of a companys intellectual property, the contents must be catal      ");
array_files[53]=new Array(0,1,"./solutions_eforms.html","2010-08-11","20K","CAYLX :: Solutions :: eForms Solutions    ","",""," CAYLX :: Solutions :: eForms Solutions -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube eForms – Information Is Everywhere In todays global economy, information is everywhere and successful businesses need to be able to capture and interact with pertinent data. Sometimes the information can be found inside the organization, safe within the security of the enterprise firewall. But more often than not, the data resides outside the organization; with customers, prospects, suppliers, constituents, and partners. The challenge with capturing information outside the organization is that the data resides in environments that you may not have control of. From different devices and platforms to working offline and on paper, these are the mediums in which your customers, prospects, suppliers, constituents, and partners operate, and you cannot control or change them. Additional e-Form Challenges Abandonment or lack of adoption of automated processes Difficulty of capturing, managing, and delivering information from disparate data sources Deployment and training for unknown and uncontrollable clie      ");
array_files[54]=new Array(0,1,"./support.html","2010-08-11","17K","CAYLX :: Support    ","",""," CAYLX :: Support -- Quick Contact Phone: 61 (2) 9986 1710 // Fax: 61 (2) 9986 1740 CAYLX Home The CAYLX Managment Team CAYLX New Zealand Solutions Business Process Management Document Management Drawing Management Data Capture e-Forms Partners Autonomy Cardiff » The Cardiff Intelligent Document Ease of Integration Hyland Software Solutions » Hyland Live Content The OnBase Difference OnBase Integrations Practical Programs ACA Pacific Products Autonomy Cardiff » Liquid Office Liquid Office Features » Process Orchestration Engine Forms Designer Process Designer Monitoring and Management Digital Approval Liquid Office eForms Liquid OfficeBPM SDK TeleForm Teleform Features TeleForm ROI TeleForm IDR Heads-Up for AP Hyland Software Solutions » OnBase OnBase Product Modules » Business Process Automation Business Rules Engine eForms Workflow Workview Practical Programs » DvTDM / DvOffice DvEMail DvScan / DvScan Pro Kodak Scanners » i1200 Series i1300 Series Support Library Contact The CAYLX Contact Cube CAYLX Support Services – All the help you need A successful solution implementation is only the beginning of a productive, long-term relationship; which is why we strive to be the very best in providing first-class product support to every customer. Standard Support Option Includes technical phone support (during standard Call Centre hours), and other benefits, such as email support and unlimited, 24x7 access to a password-protected self-service customer care portal, FAQs, product bulletins, documentation and a searchable knowledgebase. Optional, Non-Standard Support Packages Our standard Service Level Agreements (SLAs) cover most customer requirements for their chosen CAYLX information management solution. For customers with requirements not covered by our standard Service Level Agreements, we offer two additional support options: Platinum Support Option Includes all of the benefits of the Standard Support option, plus a dedicated enterprise support specialist who is a primary point of contact between CAYLX and the cus      ");
array_files[55]=new Array(0,4,"./pdf/whitepapers_practicalprograms/Dv_Scan_Overview.pdf","2010-05-24","2178K","Dv_Scan_Overview.pdf    ","","","· practical programs Make organisation easy î 9 Home Back Forward exit Print this Page easy... Make organisation § CliCk anywhere to enter · practical programs Make organisation easy î 9 Home Back Forward exit Print this Page why use Practical Programs? The sheer volume of paperbased information that organisations manage in the modern age indicates that we still remain a very long way away from the paperless office. next page DisCover why you neeD a sCanning software system. · practical programs Make organisation easy î 9 Home Back Forward exit Print this Page why scan and digitise your data? organisations searching for better ways to manage the ever increasing volume of paperbased information generated, received, processed and stored by their employees every day, need look no further than Practical Programs. in an increasingly information intensive age, management of information has become a critical issue. there has never been a greater imperative for organisations to embrace innovation and become more organised. while organisations have harnessed it tools to manage most information processing functions ­ using programs to process words, numbers, drawings and images ­ they have often failed to use sophisticated scanning software to scan hardcopy paperwork into electronic format and a document management system. in so many respects, this has been a costly oversight. document management industry data (gartner 2003) research, indicates that `knowledge workers waste 20 percent to 30 percent of their time on document management related tasks. consider the time spent on filing, searching, retrieving, copying and returning hardcopy documents. these inefficiencies are compounded by the costs associated with management of information locked in paperbased documents outside a document management system. garters research in 2003 showed that: next page · practical programs make organisation easy î 9 Home Back ForWard exit Print this PAge why scan and digitise your data? organisations searching for better ways to manage th      ");
array_files[56]=new Array(0,4,"./pdf/whitepapers_practicalprograms/Dv_Office_Overview.pdf","2010-05-24","2639K","Dv_Office_Overview.pdf    ","","","· practical programs Make organisation easy î 9 Home Back Forward exit Print this Page easy... Make organisation § CliCk anywhere to enter · practical programs Make organisation easy î 9 Home Back Forward exit Print this Page why use Practical Programs? Having access to the latest documentation is critical. Dv TDM has solved this problem. Paul taylor Department of Defence new Zealand airforce next page DisCover why you neeD a DoCument management system. · practical programs Make organisation easy î 9 Home Back Forward exit Print this Page why use a document management system? organisations searching for better ways to manage the ever increasing volume of information generated, received, processed and stored by their employees every day, need look no further than Practical Programs. in an increasingly information intensive age, management of information has become a critical issue. there has never been a greater imperative for organisations to embrace innovation and become more organised. while organisations have harnessed it tools to manage most information processing functions ­ using programs to process words, numbers, drawings and images ­ they have often failed to implement the very program which would help them manage this vast volume of information, a document management system. in so many respects, this has been a costly oversight. document management industry data (gartner 2003) research, indicates that `knowledge workers waste 20 percent to 30 percent of their time on document management related tasks. it is estimated professionals spend 5­15 percent of their time reading information, but up to 50 percent searching for it. these inefficiencies are compounded by the costs associated with management of paperbased and electronic documents outside a document management system. garters research in 2003 showed that: next page · practical programs Make organisation easy î 9 Home Back Forward exit Print this Page why use a document management system? organisations searching for better ways to manage the ever i      ");
array_files[57]=new Array(0,4,"./pdf/whitepapers_practicalprograms/Dv_TDM_Overview.pdf","2010-05-24","2602K","Dv_TDM_Overview.pdf    ","","","· practical programs Make organisation easy î 9 Home Back Forward exit Print this Page easy... Make organisation § CliCk anywhere to enter · practical programs Make organisation easy î 9 Home Back Forward exit Print this Page why use Practical Programs? Having access to the latest documentation is critical. Dv TDM has solved this problem. Paul taylor Department of Defence new Zealand airforce next page DisCover why you neeD a DoCument management system. · practical programs Make organisation easy î 9 Home Back Forward exit Print this Page why use a document management system? organisations searching for better ways to manage the ever increasing volume of information generated, received, processed and stored by their employees every day, need look no further than Practical Programs. in an increasingly information intensive age, management of information has become a critical issue. there has never been a greater imperative for organisations to embrace innovation and become more organised. while organisations have harnessed it tools to manage most information processing functions ­ using programs to process words, numbers, drawings and images ­ they have often failed to implement the very program which would help them manage this vast volume of information, a document management system. in so many respects, this has been a costly oversight. document management industry data (gartner 2003) research, indicates that `knowledge workers waste 20 percent to 30 percent of their time on document management related tasks. it is estimated professionals spend 5­15 percent of their time reading information, but up to 50 percent searching for it. these inefficiencies are compounded by the costs associated with management of paperbased and electronic documents outside a document management system. garters research in 2003 showed that: next page · practical programs Make organisation easy î 9 Home Back Forward exit Print this Page why use a document management system? organisations searching for better ways to manage the ever i      ");
array_files[58]=new Array(0,4,"./pdf/whitepapers_onbase/SOL_INTEGRATED_ERP87.pdf","2010-05-24","576K","SOL_INTEGRATED_ERP87.pdf    ","","","Government Integration Solution ERP Integrations Connect ERP data to documents for faster processes, more self-service We have centralized 74 state agencies with SAP and OnBase. Agencies have the freedom and flexibility to expand into other areas of imaging at a very low cost. ­ Glen Vose, IT Manager South Carolina Budget and Control Board The Basics Governments across the country are under pressure to overhaul or scrap legacy systems and lock in organizational knowledge before employees retire. To begin to tackle these issues, many governments are turning to ERP systems like Oracles PeopleSoft, SAP and Lawson. These applications are great for increasing access to critical data. Still, many of the processes these ERPs manage ­ like invoice processing, procurement tasks and purchasing ­ are reliant on documents as well. The Challenges You must find a way to keep documents linked with their data and processes. Fail to account for any of these three and the risks are great. The Payoff · Accessdataandsupporting documents in a single view · Improvedecisionmakingand process transparency · Increaseselfservicefor employees and constituents · Poordecisionmakingandprocessesthatprovidelittletransparencyoraccountability · ExpensivesystemsthatstilldontmeetyourneedsandstruggleforROI · Slowprocesses,lengthywaittimesandlittleself-serviceforconstituentsand employees alike The Solution OnBaseremovesthepapershacklesthatnotonlylimitself-serviceandtransparency, but your return on that new ERP. Dont wait for documents to catch up to data and transactions instantly available in your ERP. Dont spend time searching through filing cabinets or shuttling them between offices and agencies. Instead, connect OnBase to ERPs like Oracles PeopleSoft, SAP and Lawson for true process improvement. Connect departments, power payroll and other processes with ERPs Known for their powerful Accounting, Finance and HR solutions, many in the public sector choose ERPs to connect their departments. Integrating your ERP of choice with document and process m      ");
array_files[59]=new Array(0,4,"./pdf/whitepapers_caylx_casestudies/CaseStudy_admin_fund.pdf","2010-05-20","193K"," CaseStudy_admin_fund    ","","","CAYLX SOFTWARE CASE STUDY Vol 1, #3 eForms success! Client Objectives Cardi TeleForm delivers a better cost e ective solution Reduce costs Provide a better service Improve process e ciencies Our client, a large superannuation administration fund, needed to improve their process e ciencies. Thousands of letters received every day needed to be processed in a timely manner; employers needed to supply details of deductions they had made for their employees as part of compulsory superannuation, and cheques needed to be processed appropriately. The client has a large mainframe that stores all of the employer & related employee details. In addition, they use an EDMS product and a separate work ow solution. The CAYLX solution The customer already had an installation of the Cardi Teleform forms recognition software application, although it was not implemented well. Based on our experience with the product, we were able to quickly get TeleForm working as it should; data was now being collected Comprehensive forms recognition helps superannuation fund gain new business through scanning, passed to the main database, images led in the EDMS system, and a work ow procedure was started. In addition to handling the incoming transactions, we also introduced the client to TeleForm Auto Merge Publisher, with which the client was able to generate a 3 page collated letter in batches of 40,000+ document sets at a time. The client now uses TeleForm to both generate the documents that clients complete, and to process the incoming documents. The client is now gaining new business by selling the use of the technology solutions they have implemented.; using the same TeleForm solution to process transactions for nine collective funds. About TeleForm Cardi TeleForm is the only comprehensive solution to combine world-class capture with intelligent form and document processing, successfully integrating people, paper and processes. TeleForm integrates easily with the Cardi LiquidO ce platform. CAYLX Australia tel: 61 (2) 9986 1710 mob: 61 419       ");
array_files[60]=new Array(0,4,"./pdf/whitepapers_caylx_casestudies/CaseStudy_eForms.pdf","2010-05-20","191K"," CaseStudy_eForms    ","","","CAYLX SOFTWARE CASE STUDY Vol 1, #1 no more faxes! Client Objectives LiquidO ce eForms delivers a better cost e ective solution Reduce costs Provide a better service Demonstrate procedure compliance A large international government department had a need to send and receive nancial transaction requests to an Australian government department on a regular basis; 4,000 faxes a month in fact! The resulting international telecommunications costs, and the huge paper handling problem, had to be addressed. In addition there was a strict need to provide a strong audit trail, as the transactions involve large sums of public money. The CAYLX solution The client approached CAYLX to provide an eForms based solution ­ LiquidO ce. LiquidO ce, authored by Cardi Software, provides a forms repository that users can access via a web browser. A LiquidO ce forms server was installed on a Sun Solaris platform, with an Oracle database. Using the LiquidO ce forms designer, an eForm was designed to replace the Turning paper faxes into e-forms large dollar savings hard-copy fax, and the form was published to the LiquidO ce forms server; where it resides in a forms repository that can be accessed in a secure way via the browser. Now, when a new transaction is initiated the user links to the LiquidO ce eForms server and completes the form. Once the form is completed, noti cation is sent to a work queue and the next available case o cer processes the form and sends an email noti cation to the originator detailing the status of the transaction. So no more faxes, an auditable process and better customer service!; and now the client is deploying the solution internally amongst their 11,000 users. About LiquidO ce eForms LiquidO ce eForms is a powerful, Web-based software solution for creating, deploying and automatically managing the routing, tracking and approval processes for electronic forms. S OF TW A RE With over 20 years of experience in the sphere of Information Management, the team at CAYLX has a 100% success rate in the design, develo      ");
array_files[61]=new Array(0,4,"./pdf/whitepapers_caylx_casestudies/CaseStudy_Coal.pdf","2010-05-20","193K"," CaseStudy_Coal    ","","","CAYLX SOFTWARE CASE STUDY Vol 1, #1 no more faxes! Client Objectives LiquidO ce delivers a better cost e ective solution Reduce costs Provide a better service Preserve brand recognition Our client, an Australian major coal exporter, had a need to improve e ciency for transactions related to the export of coal. In the last year alone they were responsible for 92 ships leaving Australia with multiple consignments of coal bound for overseas ports. The department that handles the transactions is made up of 10 people, and an average of 27 faxes was required for each transaction! Agents all around the world needed an e cient way to lodge their transactions and track status. Equally, the client needed to preserve brand recognition and improve e ciency throughout the department. The CAYLX solution LiquidO ce was introduced as a more e cient way to get the job done while preserving brand recognition. Using LiquidO ce, forms are now linked to the clients web site On-line transactions help coal exporter improve service & save money for agents to access, transactions are lodged, deals done and costs reduced at both ends. Data is now delivered directly to invoicing and supply applications, and internal costs have been signi cantly reduced. The department now uses only 3.5 people, and delivers a better and more cost e ective solution in a timely manner, whilst continuing to preserve brand recognition. About LiquidO ce LiquidO ce provides enterprises and government organizations with a solution that automates all aspects of form-driven work ow. LiquidO ce easily creates, routes, tracks, approves and signs online eForms using industry standards - HTML, InfoPath, and PDF formats. Cardi s XML-based business process-automation solution generates database queries for real-time validation, routes forms to the appropriate departments and noti es managers by email when digital approvals are needed, resulting in e cient and secure electronic processing of information. CAYLX Australia tel: 61 (2) 9986 1710 mob: 61 419 183 250 fax: 61 (      ");
array_files[62]=new Array(0,4,"./pdf/whitepapers_onbase/WP_SAP.pdf","2008-11-27","2350K","WP_SAP.pdf    ","","","WHITE PAPER Managing and Preserving the Documents and Data that Drive SAP® Processes Five Criteria for Selecting a Solution that Satisfies Business Managers, IT and Users TABLE OF CONTENTS Introduction and Executive Summary Introduction: How ECM Complements Your SAP solution Five Criteria for Selecting a Document and Data Archiving Solution to augment your SAP solution An Overview of OnBase Solutions for Use with SAP About Hyland Software Glossary of Commonly Used Terms 3 4 5 8 9 10 2 EXECUTIVE SUMMARY Archiving has many different meanings when it comes to storing documents and data associated with an SAP solution. Enterprise content management (ECM) offers a unified approach to all of these needs, including the storage and management of incoming documents (scanned images, faxes, e-mail and more), print lists and transactional data. Using this technology to empower a comprehensive business strategy allows organizations to improve customer service, generate process improvements, cut costs, meet compliance requirements and reduce IT complexity. As ECM technology matures, it has become a common complement to ERP systems such as SAP solutions with document imaging and management, document-centric workflow and enterprise report management. The proliferation of solutions claiming to offer functionality appropriate to SAP has also increased, and organizations must raise their expectations for an ECM solution, which should include the following five criteria: · The ability to drive document-centric transactional business processes, rather than simply view documents · Maintenance of document metadata consistent with data stored in the SAP solution, even when the data in the SAP solution changes · Support for an enterprise approach for maintaining content from all sources · A flexible architecture that provides for failover and recoverability, assures fast access, supports virtually any storage strategy and enforces enterprise security policies · Vendorsupportfortheproduct,theindustryandthecustomer. What is ECM? Enterpri      ");
array_files[63]=new Array(0,4,"./pdf/whitepapers_onbase/OnBase_20page_main_brochure(72dpi).pdf","2008-11-27","6108K","OnBase_20page_main_brochure(72dpi).pdf    ","","","capture · store · search · retrieve · collaborate · manage · distribute · comply engage. empower. evolve.TM engage. empower. evolve.TM Designed to drive high-volume, highvalue transactional processes, OnBase is an enterprise-class enterprise content management (ECM) solution that helps organizations meet corporate goals and impose enterprise-wide controls and disaster recovery. More than 6,500 organizations worldwide have chosen OnBase because its price/performance r a t i o i s e a s y t o c o s t j u s t i f y, i t s configurability and rapid deployment result in lower professional service costs than many competing solutions and its ease of use minimizes training and business disruption. M a n ag i ng c o nt e nt - d r i ve n b us i ne s s processes with OnBase reduces costs, increases revenue, improves customer service and builds a platform to support g o v e r n a n c e, r i s k a n d c o m p l i a n c e initiatives. Combining industry expertise with a flexible and full-featured ECM product suite, OnBase is the basis of solutions that have improved operational efficiency and yielded the following results: · A publicly owned multi-billion dollar communications company automated accounts payable (AP) processes in its shared services division, increasing early pay discounts by 13 million in the first 10 months, strengthening internal controls and improving the ability to determine exposure and accruals. · A731-bedteachinghospitalandmajor regional referral site with 13 inpatient and outpatient facilities and 10 community health sites projects a 162% return on investment (ROI) within 3 years from an OnBase solution that integrates multiple clinical and business applications while supportingHIPAAcompliance. · A 5.2 billion bank with 38 branches increased overall productivity by 50%, improved its ability to comply with regulatory audits, reduced annual costs for document storage by 100,000 a year, reduced labor associated with tracking loan files by approximately 45,000 annually and eliminated 40,000 in microfilm       ");
array_files[64]=new Array(0,4,"./pdf/whitepapers_onbase/Five_Questions_ECM.pdf","2008-11-18","199K"," KMWWP 06_04 _1-8_c4    ","","","Five Questions to Ask When Integrating Content with Business Processes By Bill Priemer, COO, Hyland Software, Inc. T here was a time when enterprise content management (ECM) solutions were simply focused on getting control of the avalanche of physical and electronic documents and reports. A centralized solution for capturing, managing and distributing diverse documents will always be preferable to paper-based systems or disconnected silos of information and makes an excellent foundation for process improvement. However, technology buyers should ask solution providers to take content to the next level by combining knowledge of their industry and integration with core business applications to create revenue opportunities and reduce the burden of governance, risk and compliance initiatives. Content-enabling an application specific to your business makes it possible to retrieve documents and generate content-driven business process automation without ever leaving the line-of-business application users work in daily. For instance, a content-enabled accounting system can not only post payments and record transactions, but it can also display an invoice or generate an automated workflow to resolve exceptions with a mouse click or function key. In addition to freeing employees for more strategic tasks, automation reduces human error, imposes process integrity and creates an audit trail, all of which can be used to verify that accounting is in alignment with other business units to support compliance requirements such as Sarbanes-Oxley. The Five Key Questions Solution providers with the technology and experience to create the solution that will deliver results should be able to answer the following questions: 1. What can I integrate with? Most organizations run a number of applications to manage various aspects of a business or even a single business process, whether those systems are tier-one enterprise resource planning (ERP) applications or industry-specific applications. An ECM vendor should offer dedicated integrat      ");
array_files[65]=new Array(0,4,"./pdf/contact_cube/contact_cube.pdf","2008-03-01","201K"," contact_cube    ","","","S OF TWA RE Contact Cube http://www.caylx.com.au S OF TWA RE -- Mailing Address -- Caylx Software (Pacific) Pty., Ltd. PO Box 636 Mona Vale NSW 1660 S OF TWA RE Instructions: 1. Print on stiff paper 2. Cut along dotted grey lines 3. Score lightly along black lines 4. Fold and glue along flaps Tel: 61 (2) 9986 1710 Fax: 61 (2) 9986 1740 Email: support@caylx.com.au -- Support Contact -- -- Website -- Tel: 61 (2) 9986 1710 Fax: 61 (2) 9986 1740 Email: sales@caylx.com.au -- Sales Contact --     ");
array_files[66]=new Array(0,4,"./pdf/whitepapers_headsup/Solutions_Heads_Up.pdf","2008-02-29","282K"," Solutions_Heads_Up_1    ","","","CAYLX SOFTWARE CASE STUDY Vol 1, #4 Heads-Up for AP! The problem with AP Heads-Up for AP delivers a better cost e ective solution The need to pay on time Approvers & paper everywhere The potential for liability Manually keying data from forms and documents into business systems is time-consuming, costly and error prone, with high potential for compliance or privacy violations due to operator error. The CAYLX Heads-Up solution Heads-Up for Accounts Payable is an automated processing platform based on commercial o -the-shelf products (COTS) from Cardi Software, the world leader in process automation solutions. S OF TWA RE Any invoice, any time Automation for the whole AP process scanned documents into `virtual piles for further processing without any human intervention. Once captured, the Heads-Up process will pass the invoice to the chosen approvers via the internet. Heads-Up for Accounts Payable uses Cardi TeleForm to improve the capture process, and signi cantly improve accuracy and throughput. Cardi TeleForm is the only comprehensive solution to combine world-class capture with intelligent form and document processing, successfully integrating people, paper and processes. Heads-Up for Accounts Payable uses LiquidO ce to distribute invoices for approval and, delivers the data and images to their nal repositories. Heads-Up Features · Rapid automatic data capture · Automatic matching of Purchase Order to Invoices · Unlimited GL Coding · Email notification to Approvers · Automatic / Approver allocations · Integration to any ERP system to provide validation against supplier codes and delivery of invoice data · Real time view of status of all invoices · An off-the shelf solution that can be tailored to your exact requirements With over 20 years of experience in the sphere of Information Management, the team at CAYLX has a 100% success rate in the design, development, implemention and support of applications that allow organizations to reduce costs while streamlining business processes. Forms and documents come in a      ");
array_files[67]=new Array(0,4,"./pdf/whitepapers_lo/CaseStudy_Coal.pdf","2008-02-29","187K"," CaseStudy_Coal    ","","","CAYLX SOFTWARE CASE STUDY Vol 1, #2 no more faxes! Client Objectives LiquidO ce delivers a better cost e ective solution Reduce costs Provide a better service Preserve brand recognition Our client, an Australian major coal exporter, had a need to improve e ciency for transactions related to the export of coal. In the last year alone they were responsible for 92 ships leaving Australia with multiple consignments of coal bound for overseas ports. The department that handles the transactions is made up of 10 people, and an average of 27 faxes was required for each transaction! Agents all around the world needed an e cient way to lodge their transactions and track status. Equally, the client needed to preserve brand recognition and improve e ciency throughout the department. The CAYLX solution LiquidO ce was introduced as a more e cient way to get the job done while preserving brand recognition. Using LiquidO ce, forms are now linked to the clients web site On-line transactions help coal exporter improve service & save money for agents to access, transactions are lodged, deals done and costs reduced at both ends. Data is now delivered directly to invoicing and supply applications, and internal costs have been signi cantly reduced. The department now uses only 3.5 people, and delivers a better and more cost e ective solution in a timely manner, whilst continuing to preserve brand recognition. About LiquidO ce LiquidO ce provides enterprises and government organizations with a solution that automates all aspects of form-driven work ow. LiquidO ce easily creates, routes, tracks, approves and signs online eForms using industry standards - HTML, InfoPath, and PDF formats. Cardi s XML-based business process-automation solution generates database queries for real-time validation, routes forms to the appropriate departments and noti es managers by email when digital approvals are needed, resulting in e cient and secure electronic processing of information. CAYLX Australia tel: 61 (2) 9986 1710 mob: 61 419 183 250 fax: 61 (      ");
array_files[68]=new Array(0,4,"./pdf/whitepapers_lo/Cardiff_ftwp_101906.pdf","2008-02-27","641K"," CDF: Intelligent Documents. Better BPM A Guide to Accelerating Your Most Demanding Business Processes     "," CDF: Intelligent Documents. Better BPM A Guide to Accelerating Your Most Demanding Business Processes     "," CDF: Intelligent Documents. Better BPM A Guide to Accelerating Your Most Demanding Business Processes     ","A Guide to Accelerating Your Most Demanding Business Processes Intelligent Documents. Better BPM Cardiff White Paper Intelligent Documents. Better BPM A Guide to Accelerating Your Most Demanding Business Processes July 2006 Table of Contents Foreword . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 Intelligent Documents. Better BPM: Streamlining Organizations with Smarter Technology . . . . 3 The Case for Intelligent Documents 3 High Return Projects 4 Customer-facing Processes 4 HR and Other Internal Administrative Processes 4 Financial Operations 5 Overview of Cardiffs Solutions for Intelligent Documents . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 Gaining Control over Paper-based Processes with TeleForm 5 TeleForm Process Flows 5 TeleForms Return on Investment Potential 6 Typical ROI Scenario 6 Before TeleForm: 6 After TeleForm: 6 TeleForms Advantages over Other Content Capture Solutions 6 Typical ROI Calculation for TeleForm 6 Before TeleForm--manual data entry 6 After TeleForm--automated content capture 7 Financial Benefits 7 TeleForm Benefit and ROI Summary 7 Streamlining Processes with eForm Technology from LiquidOffice 7 LiquidOffices Return on Investment Potential 8 Typical ROI Scenario: 8 Before LiquidOffice: 8 After LiquidOffice: 8 LiquidOffices Advantages over other eForm and BPM Solutions 8 Typical ROI Calculation for LiquidOffice 9 Before LiquidOffice 9 After LiquidOffice 9 Financial Benefit 9 LiquidOffice Benefit and ROI Summary 9 Conclusion . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 About Cardiff . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 Intelligent Documents. Better BPM Foreword The goal of this white paper is to help your company      ");
array_files[69]=new Array(0,4,"./pdf/whitepapers_lo/liquidBPM.pdf","2008-02-19","1790K","liquidBPM.pdf    ","","","LiquidBPMTM C A R D I F F Embeddable Business Process Management Designed from the ground up to be embedded Process Modelling Process Automation Business Activity Monitoring Embed Business Process Management in Your Application The Cardiff LiquidBPM Software Developers Kit (SDK) lets independent software vendors (ISVs) and system integrators (SIs) to rapidly integrate advanced business process management capabilities into their applications. A comprehensive API provides the developer with unmatched capabilities when building applications that require process automation. The SDK includes everything needed to develop applications with workflow, including the Cardiff LiquidBPM Studio, the Cardiff LiquidBPM Engine, and the Cardiff LiquidBPM Manager. Other SDK features include: · Codegeneratorstosimplifyintegrationwith external systems through custom tasks. Code generators for interfacing with RMI, CORBA, EJB, and web services are included. · Sourcecodeforpre-builtend-userinterfaces are included to accelerate development and integrationofuser-interactioncomponents. · BoththickandthinclientsfortheCardiffLiquidBPMManager,whichcanbeusedas-isor be fully customized and included within a larger GUI framework. · Pre-definedtaskstodefineelectronicforms and automatically generate them without any programming whatsoever. Studio Workflow Manager Web Task Manager Dynamic Workflow JAVA Application Task Library Resource Adapter Web Service Enterprise JAVA Beans High-Performance State Machine .NET Application Rules Engine Service Schedule XML Engine JAVA Message Queues J2EE Connector Architecture Enterprise Information Systems Relational Database LDAP Flexible Automation and Workflow Reporting Tools A highly-optimized runtime Java process engine component, the LiquidBPM Engine is the core component of LiquidBPM. Its numerous features include caching, thread-pooling, persistence, clustering, load balancing, notification and scalability. The LiquidBPM Engines ability to automate processes improves efficiency and increases throughput      ");
array_files[70]=new Array(0,4,"./pdf/whitepapers_lo/ccom_accounts_payable_sol.pdf","2008-02-18","610K"," Accounts Payable Overview, Cardiff    "," Accounts Payable Overview, Cardiff    "," Accounts Payable Overview, Cardiff    ","Accounts Payable Overview Cardiff Intelligent Documents for Accounts Payable (AP) Accounts Payable departments are under constant pressure to reduce costs, and most of those costs are directly attributed to the manual, inefficient methods of processing that take place throughout the entire AP lifecycle, from transporting hard copies of invoices from distributed office locations, to manual preparation and sorting, manual data entry, tracking discounts, and researching payment terms. And according to the International Accounts Payable Professional organization1, labor-intensive manual and paper-based processes have always been the biggest problem in accounts payable departments. Because manual processing methods are so error prone and inefficient, they can lead the organization to even greater associated costs that result from issues like duplicate and unauthorized payments, lost documents, missed discounts, compliance fines, late fees and more. This is why so many organizations today are turning to Cardiff to automate their Accounts Payable processes. By automating not only the manual preparation and data entry steps, but also employing automated business processing rules to ensure best practices are being followed, organizations significantly reduce or eliminate the costs and risks associated with previous processing methods. Cardiff Intelligent Documents For the past 15 years, Cardiff has provided organizations of all sizes, including the Global 2000, the premier solution focused on streamlining and simplifying the myriad of complex connections between the people, documents and processes that are critical to their businesses. With a flexible architecture and the ability to process both paper documents and online information, the Cardiff solution extends the power of existing business systems in a way that enhances their value and makes them easier for people to work with. The result seamless integration into the overall AP process, including real-time access to SAP R/3, Oracle business solutions and all other       ");
array_files[71]=new Array(0,4,"./pdf/whitepapers_lo/IDC-Autonomy-Cardiff-Profile.pdf","2008-02-18","233K","IDC-Autonomy-Cardiff-Profile.pdf    ","","","CUSTOMER NEEDS AND STRAT EGIES Autonomy Cardiff Intelligent Documents Offer Dynamic Approach to BPM Maureen Fleming IDC OPINION Autonomy Cardiff Intelligent Document software is built around the concept of the intelligent document, which contains its own rules about information that needs to be captured, what needs to be approved, and where the intelligent document needs to go to collect the information and approvals. This approach makes Cardiffs Intelligent Document framework for process automation very dynamic. The Intelligent Document framework -- LiquidOffice BPM, eForms, and Mobile, along with TeleForm -- extends across mobile platforms, paper-based forms, and the browser. One enterprise interviewed for this study was able to reduce data entry time from an average of six minutes down to seconds through the use of Cardiff software. Although performance improvements have not been fully measured, this human resource outsourcer will decrease cycle times and increase its time to first revenue through its implementation of LiquidOffice. The project is aimed at streamlining the process around client and employee onboarding. A Fortune 100 bank has standardized its departmental BPM on LiquidOffice and has successfully deployed it in several projects, including money transfer investigations and general ledger process automation. In addition, the bank also has standardized on TeleForm for capturing data from paper forms and documents. Autonomy Cardiff offers a strong solution for those organizations that: ! Have paper-centric automation requirements ! Are automating tasks around people, where ease of use would greatly simplify adoption ! Need to automate processes with key activities that dont follow a predictable path and can benefit from a more dynamic and ad hoc approach Global Headquarters: 5 Speen Street Framingham, MA 01701 USA P.508.872.8200 F.508.935.4015 www.idc.com Filing Information: May 2007, IDC #206733, Volume: 1 Business Process Management Software: Customer Needs and Strategies IN THIS STUDY This stud      ");
array_files[72]=new Array(0,4,"./pdf/whitepapers_lo/eforms_overview.pdf","2008-02-13","967K","eforms_overview.pdf    ","","","LiquidOffice TM eforms C A R D I F F Improve data quality, enhance employee productivity and reduce operational costs LiquidOffice eForms provides businesses and government organizations with a solution that automates all aspects of form-driven processes. Forms-Driven Process Automation Now, more than ever before, organizations are investing in software solutions that reduce costs, increase productivity and improve customer service. For many organizations, the largest, most tangible savings are achieved by replacing manual paper processes with online forms and documents. Cardiff LiquidOffice eFormsTM is a powerful, Web-based software solution for creating, deploying and automatically managing the routing, tracking and approval processes for electronic forms. LiquidOffice is simply the fastest way for organizations to put all their corporate forms and processes online. LiquidOffice eForms provides businesses and government organizations with a solution that automates all aspects of formdriven processes. LiquidOffice eForms easily creates, routes, tracks, approves and signs online eForms using industry standards, including XML, HTML and PDF formats. Cardiffs XML-based process automation solution generates database queries for real-time validation, routes forms to the appropriate departments and notifies managers by email when digital approvals are needed, resulting in efficient and secure electronic processing of information. By leveraging industry standards, Cardiffs solution promises to be the last migration customers will have to make. Generating Real Business Value with Cardiff LiquidOffice eForms LiquidOffice eForms enables organizations to stay competitive by increasing the efficiency and productivity of every employee in the organization. · Rapid return on investment--Eliminateswaste associatedwithmanualprocesses,printing andstoring.Savesupto150perform-driven process. · Increases employee productivity--UtilizingstandardWebbrowsers,usershave24/7 accesstodynamicHTMLorPDFformswith intelligentfeatures,includin      ");
array_files[73]=new Array(0,4,"./pdf/whitepapers_lo/mk0697.pdf","2008-02-13","1524K"," Cardiff LiquidOffice: Cardiff Intelligent Documents-People. Information. Process.    "," Cardiff LiquidOffice: Cardiff Intelligent Documents-People. Information. Process.    "," Cardiff LiquidOffice: Cardiff Intelligent Documents-People. Information. Process.    ","Cardiff Intelligent Documents People. Information. Process. Cardiff LiquidOffice People. Information. Process. LiquidOffice encompasses the entire business process management lifecycle from process design and simulation to deployment and optimization. However, it goes well beyond traditional process management. LiquidOffice embeds intelligence within forms and documents, enabling them to securely and automatically navigate the process between people and systems, offering visibility into each step of the process and a complete audit trail. LiquidOffice is a cornerstone element of the Cardiff Intelligent Document platform, which offers the industrys most comprehensive and versatile information capture and business process management capabilities. Cardiff Intelligent Documents streamline and simplify the complex maze between people, documents and processes that are critical to businesses, with a flexible and scalable architecture and no barriers between paper, online and mobile information. Cardiff Intelligent Documents are the information and process onramp to the enterprise, dramatically reducing costs, shrinking process cycles and offering complete visibility into business process status at every step. Intelligent Documents: A breakthrough link between information management and business process. --Gartner Features Information Capture and User Experience eForms Cardiff LiquidOffice eFormsTM is a powerful, Web-based software solution for creating, deploying and automatically managing the routing, tracking and approval processes for electronic forms. LiquidOffice eForms capabilities range from internal corporate Web forms to the comprehensive rules-based forms that drive the core of an organizations business. Paper Automation One of the most powerful capabilities built into LiquidOffice is the ability to seamlessly capture paper forms and documents and connect them to processes that may already be active. In fact, LiquidOffice is the only integrated and unified solution that supports a single, consistent and audi      ");
array_files[74]=new Array(0,4,"./pdf/whitepapers_lo/cardiff_liquid_office_web.pdf","2008-02-13","850K","cardiff_liquid_office_web.pdf    ","","","LiquidOffice TM Business Process Management & Intelligent Documents C A R D I F F Cardiff LiquidOffice People. Information. Process. LiquidOffice encompasses the entire business process management lifecycle from process design and simulation to deployment and optimization. However, it goes well beyond traditional process management. LiquidOffice embeds intelligence within forms and documents, enabling them to securely and automatically navigate the process between people and systems, offering visibility into each step of the process and a complete audit trail. LiquidOffice is a cornerstone element of the Cardiff Intelligent Document platform, which offers the industrys most comprehensive and versatile information capture and business process management capabilities. Cardiff Intelligent Documents streamline and simplify the complex maze between people, documents and processes that are critical to businesses, with a flexible and scalable architecture and no barriers between paper, online and mobile information. Cardiff Intelligent Documents are the information and process onramp to the enterprise, dramatically reducing costs, shrinking process cycles and offering complete visibility into business process status at every step. Features eForms Cardiff LiquidOffice eFormsTM is a powerful, Web-based software solution for creating, deploying and automatically managing the routing, tracking and approval processes for electronic forms. LiquidOffice eForms capabilities range from internal corporate Web forms to the comprehensive rules-based forms that drive the core of an organizations business. Outlook Integration LiquidOffice integrates seamlessly with Microsoft Outlook. A LiquidOffice folder can be automatically pushed to the Microsoft Outlook client allowing users to navigate to the LiquidOffice Folders, Inbox, Sent Items, Saved Items, and Work Queues. Paper Automation One of the most powerful capabilities built into LiquidOffice is the ability to seamlessly capture paper forms and documents and connect them to proce      ");
array_files[75]=new Array(0,4,"./pdf/whitepapers_lo/cardiff_company_overview_web.pdf","2008-02-13","1626K","cardiff_company_overview_web.pdf    ","","","Cardiff, an Autonomy Company Forms and documents are the fabric that connects people to business. Imagine the improvement you could see in your business if the ones you use everyday suddenly contained intelligence about where they needed to be routed and which systems needed the data they contained. What if you could automatically extract business information from paper documents as easily as from online forms? What if you could find any document at any time no matter who was working on it while resting assured that all of the information was secure from unauthorized access? Cardiff Intelligent Documents have a conceptual understanding of the information they contain. This meaning-based approach enables each form or document to provide a richer user experience, route itself to the right people, enforce company procedures and manage interactions with other business systems. With a flexible architecture and the ability to process paper documents, online and mobile information, Cardiff gives organizations the ability to execute more effectively than the competition. Unrivalled Expertise For over 15 years Cardiff has been providing cutting-edge solutions to a distinguished list of customers that includes: Cardiff is part of the Autonomy group, which is recognized by industry analysts such as Gartner, IDC and Forrester Research as the international leader in high-end information processing and management. · · · Over 17,000 customers worldwide 4bn market capitalisation 60m invested in R&D annually · · · 75m cash in bank and no net debt 400 VARs and Integrators 300 OEM Partners The Intelligent Document Key Benefits · · · · · · · · · · Reduce the cost of data entry Enhance the user experience Complete processes more rapidly Handle exceptions more efficiently Reduce duplication of effort Improve information security Improve process control and visibility Ensure compliance with regulatory mandates Interact with processes on the move Improve collaboration and leverage expertise User Experience Process Intelligence Enhance      ");
array_files[76]=new Array(0,4,"./pdf/whitepapers_teleform/teleformhighavailable.pdf","2008-02-13","523K"," MK0736 Running TeleForm Enterprise in a High Availability Environment White Paper    "," Running TeleForm Enterprise in a High Availability Environment White Paper. New features in TeleForm Enterprise Version 9.1 go beyond compatibility and allow TeleForm to be aware of clustered Microsoft SQL Servers and clustered Microsoft File Servers.     "," Running TeleForm Enterprise in a High Availability Environment White Paper    ","Running TeleForm Enterprise in a High Availability Environment Verity White Paper Running TeleForm Enterprise in a High Availability Environment August 2005 Table of Contents: Objective . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 Background . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 Infrastructure Risk Areas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 Servers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 Workstations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 TeleForm Support for High Availability . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 TeleForm Internal Database (MS SQL Server) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 Typical Clustered Server . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 Linking TeleForm to the Cluster . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 Failover Process . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 TeleForm Internal File Storage (MS File Server) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 TeleForm License Services . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 Summary . . . .       ");
array_files[77]=new Array(0,4,"./pdf/whitepapers_teleform/TeleForm10Brochure.pdf","2008-02-13","1357K"," Cardiff TeleForm Overview    ",""," Cardiff TeleForm Overview, June 2006    ","Any Form. Any Document. Anytime. You are global and local You are agile and regulated You are speed and quality ... and like many organizations you struggle to achieve these balances because many of your critical processes are paper-based and difficult to manage. That is, unless, you are one of over 8,000 of the worlds largest organizations that believe a key to their competitiveness and success today is their ability to automate their paper-based processes with Cardiff TeleForm. Teleform is a cornerstone piece of the Cardiff Intelligent Document solution. Unlike a traditional static document which is disjointed from the process, systems and data that it is a part of, a Cardiff Intelligent Document that originates from either paper or electronic submission is aware of its environment and context. The document knows how to securely navigate the process between people and systems and makes recommendations to the user based on current and historical conditions in order to ensure data accuracy and integrity. With the unparalleled flexibility of Cardiff®, organizations efficiently capture information from paper and electronic sources--regardless of complexity. TeleForm is the only comprehensive solution to combine world-class capture with intelligent form and document processing, successfully integrating people, paper and processes. control. Before you process them, they must be sorted. Rather than using separator sheets or presorting documents by hand, a time consuming and costly endeavor, Cardiff TeleForm intelligently identifies form and document types of varied structures and formats, based on their content using a robust suite of identification methods and automatically sorts scanned documents into virtual piles for further processing without any human intervention. Intelligent Form and Document Capture In order to automate your paper-based processes you need support for the tools that your users already know and use on a day-to-day basis. Thats why Cardiff TeleForm delivers a complete range of alternatives for      ");
array_files[78]=new Array(0,4,"./pdf/whitepapers_lo/Intelligent%20Document%20Processing%20-%20Brochure.pdf","2008-02-13","1477K","Intelligent Document Processing - Brochure.pdf    ","","","Intelligent Document Processing Paper and electronic documents are the fabric that connects people to business. Imagine the improvement you could see in your business if the documents and forms that you use everyday suddenly contained intelligence about where they needed to be routed and which systems needed the data they contained. What if you could automatically extract business information from paper documents as easily as from online forms? And what if you could find any document at any time no matter who was working on it while resting assured that all of the information was secure from unauthorized access? Open, Non-proprietary eForms With Cardiffs powerful, Web-based eForm capabilities, organizations can create, deploy and automatically manage the routing, tracking and approval processes for electronic forms. The eForms are open, non-proprietary and version independent, giving users an easy-to-use interface with the comfortable familiarity of paper. The business friendly interface enables nontechnical users, those with the most direct knowledge of business requirements, to build the forms. Cardiff Intelligent Document Processing ® - a solution focused on streamlining and simplifying the myriad of complex connections between the people, documents and the processes that are critical to your business. With a flexible architecture and the ability to process both paper documents and online information, the Cardiff solution extends the power of your existing business systems in a way that enhances their value and makes them easier for people to work with. The result is smoother processing for both your customers and your staff, dramatically reduced cost of data entry, and complete visibility to process status at every point in the cycle. passes between people and systems. Cardiff Intelligent Document Processing captures the information and navigates the process behind each form or document in a way that improves efficiency, manages complexity, allows for rapid change and enhances the customer experience. The e      ");
array_files[79]=new Array(0,4,"./pdf/whitepapers_lo/LiquidOffice_Features_and_Benefits.pdf","2008-02-12","39K"," Microsoft Word - LOFBv5-Final 2-02-07.doc    ","","","LiquidOffice v5.0 Features and Benefits Matrix The latest release of Cardiff LiquidOffice extends the industrys most comprehensive and versatile capture and process automation solution ­ Cardiff Intelligent Documents. Cardiff Intelligent Documents streamline and simplify the complex maze between people, documents, and processes that are critical to businesses. With a flexible and scalable architecture and no barriers between paper and online information, Cardiff Intelligent Documents are the information and process onramp to the enterprise, dramatically reducing costs and offering complete visibility into business processes status at every point in the cycle. LiquidOffice v5.0 significantly increases the breadth and depth of Cardiffs Intelligent Document solution, incorporating functionality that extends the reach of enterprise business process automation. The new mobile device support allows users to remotely participate in critical time-sensitive business decisions. The new 2D Bar Code support adds the ability for public users to fill, print and sign documents that automatically know the next steps in the process and the information that they contain. The greatly expanded Process Studio API offers organizations increased flexibility to tailor their solution specifically to their needs, giving even more power to tie into existing systems and processes. Enhancements to reporting provide a deeper view into real-time business activities and make auditability and compliance even more transparent and enforceable. Accelerate Business Feature Support for Blackberry (Mobile support) · · Description LiquidOffice handheld application is installed on Blackberry to access and approve forms. Form data viewed on handheld can be customized at design time to specify what fields are displayed to the approver. Benefit Decision makers can now approve forms away from their computer using a handheld device. Embedded 2D barcode · · · · Industry-standard barcodes generated based on the data in fields filled out by the user. Add 1D o      ");
array_files[80]=new Array(0,4,"./pdf/whitepapers_lo/LiquidofficeArchitecture.pdf","2008-02-12","373K"," Microsoft Word - LOv5 Architectural document.doc    ","","","LiquidOffice v5 Architecture/Technologies Copyright 2007, Cardiff, An Autonomy company. All rights reserved. OVERVIEW ................................................................................................................................................. 3 Components .......................................................................................................................................... 3 1. STORAGE ................................................................................................................................................ 5 1.1. Static Elements............................................................................................................................... 5 1.2. Dynamic Elements ......................................................................................................................... 7 2. COMMUNICATION ............................................................................................................................. 11 2.1. Client-Tier - Web Server Tier Communication....................................................................... 12 2.2. Web Server Tier- Application Tier Communication ............................................................... 12 2.4. Application Tier - Data Tier .................................................................................................. 12 3. CLUSTERING........................................................................................................................................ 12 3.1. Cluster Tag .................................................................................................................................. 12 3.2. Front loaded Load Balancing ...................................................................................................... 12 3.3. Clustered Process Server Files .................................................................................................... 12 4. CONFIGURATIONS ................................................      ");
array_files[81]=new Array(0,4,"./pdf/whitepapers_kodak/CaptureSoftware.pdf","2008-01-24","573K","CaptureSoftware.pdf    ","","","Capture Software Make your scanning workflow more efficient Software that redefines productivity Kodak Capture Software is an easy-touse production scanning application that enables all the versatility, productivity and reliability thats built into feature-rich Kodak Scanners. Versatility. Kodak Capture Software can be tailored to meet the needs of virtually any scanning workload, from front-end capture applications to imaging, forms processing and workflow applications. It lets you scan, index, batch and output simplex and duplex documents as color, bitonal and grayscale* images to many popular applications in a multitude of formats, including TIFF, JPEG and PDF. And it can also generate e-mails that contain scanned documents (PDF or TIFF attachments), splitting them into multiple e-mails automatically if document size exceeds e-mail system limits. Productivity. Numerous features help you boost throughput, meet deadlines, and do more with less. Quickly check up to eight scanned pages at a time with the high-speed viewer. Improve productivity by producing bitonal and color images simultaneously. Use bitonal for fast bar code and zonal OCR indexing while color images are delivered to your document management system. Eliminate most of the manual work with automation, high efficiency and productivity. A wide range of post-scan editing tools, including rescan, rotate, reorder and cropping further improves your productivity. And it all happens at the push of a button. Reliability. More than 15,000 users worldwide rely on Kodak Capture Software to capture their critical documents and index data. Customers can count on the softwares robust functionality, our continuous product refinement, and a no-cost image verification feature that confirms that scanned images have not been altered. Usability. After installing the software, youre immediately ready to scan. Capture Software works with all Kodak Scanners so operators can easily run any model using the same graphic interface. The bundled Find-and-View application lets       ");
array_files[82]=new Array(0,4,"./pdf/whitepapers_kodak/i1300Scanner.pdf","2008-01-24","257K"," KGCG_i1300_SellSheet.indd    ","","","i1300 series scanners A powerful combination of performance and value, for all your departmental scanning needs Lets get right to it--the Kodak i1310 and i1320 scanners deliver the highest level of capability and affordability of any product in their category. This is true breakout performance, with ease of use, versatility and image quality that sets a new benchmark. · Printers · Other desktop applications that support TIFF, JPEG, RTF, PDF and searchable PDF output In addition, the i1300 series scanners have a unique tilt-and-scan feature that allows you to easily select the best scanning position for your job: · Flat with trays extended for highervolume batch scanning · Fully upright with the input tray folded down for ad hoc and transaction feeding (your scanner can even be positioned up against a wall and still auto-feed documents) And theres an optional tethered flatbed accessory (A4 size) for maximum convenience. In just seconds, attach the flatbed and scan your exception documents at up to 1200 dpi optical resolution. When youre finished, simply unplug and store the flatbed. Its that easy! Kodak exclusive. This gives you images of exceptional quality--about as automatically as it gets. No need for rescans! Flexibility to meet wide-ranging needs You can auto-feed virtually any document, from the size of a drivers license up to 863 mm (34 in.) long-- at speeds up to 60 pages per minute. Scan both sides of documents in a single pass and output images in color, bitonal or grayscale. Our smart touch feature allows you to easily select the right scanning application for all kinds of jobs. At the touch of a button, scan documents to: · File · E-mail Finally, you can get high performance, ease of use and value at an affordable price point When you combine our image quality, ease of use and overall performance with the peace of mind that comes with Kodak Service & Support, the i1300 series delivers truly awesome value. Enjoy sharp image quality The i1310 and i1320 models feature 600 dpi optical resolution and enh      ");
array_files[83]=new Array(0,4,"./pdf/whitepapers_kodak/i1200Scanner.pdf","2008-01-24","254K"," KGCG_i1200_SellSheet.indd    ","","","i1200 series scanners Meet all your workgroup needs with an easy-to-use scanner that fits just about anywhere. Small, powerful and packed with features and benefits, the Kodak i1210 and i1220 scanners deliver on your desktop scanning needs. They can auto-feed almost anything at speeds up to 30 pages per minute, including documents as small as an identification card or as long as 863 mm (34 in.). The i1200 series scanners provide you with a wide range of output options--including searchable PDF files for easy information access. · Other desktop applications that support TIFF, JPEG, RTF, PDF and searchable PDF In addition, these powerful scanners have a unique tilt-and-scan feature that allows you to select the best scanning position for the job: · Flat with trays extended for higher-volume batch scanning · Fully upright with the input tray folded down for ad hoc and transaction scanning (you can even position the scanner up against a wall and still auto-feed documents) Theres also an optional tethered flatbed scanner (A4 size) for more convenience and flexibility. Simply attach the flatbed and scan your exception documents at up to 1200 dpi optical resolution. Then just unplug and store the flatbed. Its that easy! enhanced Perfect Page image processing for outstanding image quality thats virtually automatic. No need for rescans! All the ease of use and versatility youre looking for-- no matter what the job is. Our smart touch feature enables you to select the right scanning application for the job. With the touch of a button, scan documents to: · File · E-mail · Printers Get exceptional image quality It starts with 600 dpi optical resolution for razor-sharp images. But we didnt stop there. These compact machines feature Enjoy unique value With all this capability, affordable pricing and the peace of mind that comes with Kodak Service & Support, the i1210 and i1220 scanners deliver an extraordinary combination of performance and value. i1200 series scanners Recommended Daily Volume Throughput Speeds (portrait, le      ");
array_files[84]=new Array(0,4,"./pdf/whitepapers_practicalprograms/DvTDM_Reference_Files.pdf","2008-01-22","824K","DvTDM_Reference_Files.pdf    ","","","DRAWING MANAGEMENT SOLUTIONS S OF TWA RE Dv TDM and C AD Reference Files Managed Right, Ever y Time! What are Reference Files? Reference files are CAD files that are associated with other CAD files so that, when correctly related and available, they result in a more efficient complete drawing (see samples below). This could take the form of something as simple as creating a new drawing and `inserting the title sheet as an associated reference file, or the more complex insertion of reference files for parts, standard drawings, etc. Example A When the resulting parent drawing is opened, it automatically opens all the associate reference files. Further, the same reference files can be associated with an unlimited number of parent drawings, thereby making it possible for one drawing to be inserted in to hundreds of others. Example B RCP NOTATIONS PLAN GEOMETRY Examples courtesy ASSI CAD Drafting © 2008 CAYLX Software (Pacific) Pty., Ltd. All rights reserved. CAYLX®, and the CAYLX logo are registered trademarks. Practical Programs® and Dv TDMTM are trademarks of Practical Programs Pty., Ltd.. Reference File Management Problems and Solutions The problems caused by poor reference file management fall into two categories; broken links and version control errors. Broken Links When a reference drawing is inserted into a parent drawing, the path to the reference file is recorded. If that reference is deleted, moved or renamed the link is broken; something that often occurs when drawings are sent to third parties, and bringing into question whether all the required reference files were sent and whether the recipient be able to view them correctly? Version Control - Option One When a new version is created, Dv TDM automatically converts the original file and all the associated reference files into a vector-based PDF and renames the resulting PDF file with the appropriate version number. The current working drawing does not contain the version number; which is done on purpose so a Dv users clients do not know the number of v      ");
array_files[85]=new Array(0,4,"./pdf/whitepapers_teleform/TeleFormFB.pdf","2008-01-12","131K"," Microsoft Word - tffBv10_final_15May06    ","","","TeleForm v10 Features and Benefits Matrix Cardiff® TeleForm® v10 expands upon fifteen years of proven excellence to offer the capability to capture unstructured as well as semi-structured data. Whether you process loan applications or clinical information, simple forms or complex sets, TeleForm v10 provides an easy-to-use, scalable platform that equips your organization to capture data from most any source in a secure, dependable environment; and then to track , audit and search the process behind the form giving you maximum efficiency and ensuring compliance to organization and government regulation. TeleForm v10 enables you to: Automatically capture and index any form or document type Easily and rapidly fold information from paper into electronically-based workflows from both distributed and centralized locations Embed intelligence within the form to navigate the business process Enforce internal and external regulatory compliance requirements Increase productivity across a disparate, global enterprise Capture, index and process any structured or unstructured document type Feature Content-based classification Description Automatically classifies and sorts semiand unstructured layouts via full page keyword and phrase identification algorithms. Benefit · Reduce implementation time by setting up one classification rule for like types of forms and documents (e.g. invoices, purchase orders and correspondence). · Eliminate manual preparation steps, like sorting (document separator sheets, barcode ID applications) at capture. · Embed unique indexing and rules for automatic processing. (Base classification capabilities included in all 3 tiers; advanced classification capabilities optional ) Automatic extraction Automatic extraction and population of key indexes from semi- and unstructured layouts. · Improve resource utilization by reducing manually keying from image. · Enable search for later retrieval of in-process and committed files. (Base classification capabilities included in all 3 tiers; advanced classificatio      ");
file_count=86;